Recombinant Mouse Reticulon-4 receptor-like 1 (Rtn4rl1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Reticulon-4 Receptor-Like 1 (Rtn4rl1)

Reticulon-4 receptor-like 1 (RTN4RL1), also known as Reticulon 4 Receptor Like 1, is a protein-coding gene . The RTN4RL1 gene is associated with certain diseases, including microcephaly and epilepsy .

Gene Information

  • Nomenclature The official full name is Reticulon 4 Receptor Like 1, and the symbol is RTN4RL1 .

  • Function RTN4RL1 is a protein-coding gene .

  • External Links RTN4RL1 has links to bioinformatics resources such as OMIM (610461), NCBI Entrez Gene (146760), and UniProt (Q86UN2) . Genome browsers like Ensembl and UCSC also provide information .

Expression and Tissue Distribution

The COSMIC database provides information regarding the distribution of mutations across primary tissue types . This includes data from targeted and whole genomes/exome resequencing, where all protein-coding genes are screened for mutations .

Variants and Mutations

  • COSMIC Data The COSMIC (Catalogue Of Somatic Mutations In Cancer) database contains a variety of data on mutations, including single base substitutions, complex mutations, and insertions and deletions .

  • Mutation Types The types of mutations observed in samples for this gene are summarized in charts, with the number of samples recorded as having a particular type of mutation . A sample may have more than one type of mutation .

  • LOVD Data The Global Variome shared Leiden Open Variation Database (LOVD) lists all variants in the RTN4RL1 gene, described using the NM_178568.2 transcript reference sequence .

Drug Resistance

RTN4RL1 is associated with drug resistance mutations . Alternative transcripts are displayed for genes where reported resistant mutations are not located on the canonical transcript but are on the alternative, and also where reported resistant mutations are located at the same genomic position on both the canonical and alternative transcripts or on overlapping genes and/or fusions and share a COSMIC ID .

Related Research

Research has explored the use of Retinol-Binding Protein 4 (RBP4) antagonists in the context of retinal diseases .

RBP4 Antagonists and Bisretinoid Formation Lipofuscin bisretinoids contribute to the pathogenesis of macular degeneration . RBP4 antagonists can reduce serum retinol concentrations, which reduces retinol delivery to the retina and decreases bisretinoid synthesis .

BPN-14136 BPN-14136 is an RBP4 antagonist with good in vitro potency and selectivity and optimal rodent pharmacokinetic characteristics . Studies have been conducted to evaluate its pharmacokinetics (PK) and pharmacodynamics (PD) in dogs and non-human primates (NHP) . BPN-14136 exhibited a favorable PK profile in both species, with dose-normalized exposure being significantly higher in NHP than in dogs . Oral administration of BPN-14136 to NHP induced a strong 99% serum RBP4 reduction .

Data Tables

Mutation Data from COSMIC

Mutation (Amino Acid)Mutation ID (COSF)CountMutation Type
(Data not provided in the available context)(Data not provided in the available context)(Data not provided in the available context)(Data not provided in the available context)

Methylation Data from COSMIC

Sample NameSample IDProbe IDProbe Posn.Type High (Hypermethylation); Beta-Value > 0.8 and differs from normal average by > 0.5 Low (Hypomethylated); Beta-Value < 0.2 and differs from normal average by > 0.5Level (Beta-Value)Normal AverageStudy
(Data not provided in the available context)(Data not provided in the available context)(Data not provided in the available context)(Data not provided in the available context)(Data not provided in the available context)(Data not provided in the available context)(Data not provided in the available context)(Data not provided in the available context)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Rtn4rl1; Ngrl2; Reticulon-4 receptor-like 1; Nogo receptor-like 2; Nogo-66 receptor homolog 2; Nogo-66 receptor-related protein 3; NgR3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-424
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Rtn4rl1
Target Protein Sequence
CPRDCVCYPAPMTVSCQAHNFAAIPEGIPEDSERIFLQNNRITFLQQGHFSPAMVTLWIY SNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSALPAGI FGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLL HENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRAR SLWEWLRRFRGSSSAVPCATPELRQGQDLKLLRVEDFRNCTGPVSPHQIKSHTLTTSDRA ARKEHHPSHGASRDKGHPHGHPPGSRSGYKKAGKNCTSHRNRNQISKVSSGKELTELQDY APDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS
Uniprot No.

Target Background

Function

Reticulon-4 receptor-like 1 (Rtn4rl1) is a cell surface receptor with functionally redundant roles in postnatal brain development and adult central nervous system axon regeneration. It contributes to normal axon migration across the brain midline and corpus callosum formation. Rtn4rl1 protects motoneurons from apoptosis, potentially via MAG mediation. It inhibits neurite outgrowth and axon regeneration by binding to neuronal chondroitin sulfate proteoglycans. Furthermore, it binds heparin and, like other family members, regulates dendritic spine and synapse number during brain development. Its signaling activates Rho, leading to actin cytoskeleton reorganization.

Gene References Into Functions
  1. This study identifies NgR1 and NgR3 as CSPG receptors, highlighting functional redundancy among CSPG receptors and shared mechanisms of MAI and CSPG inhibition. PMID: 22406547
  2. Rtn4rl1 is predominantly expressed in embryonic and adult nervous system neurons. PMID: 14664809
Database Links
Protein Families
Nogo receptor family
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Membrane raft. Perikaryon. Cell projection.
Tissue Specificity
Detected in brain (at protein level). Detected in retina ganglion cell layer and inner nuclear layer.

Q&A

What is the basic structure and function of mouse Rtn4rl1?

Rtn4rl1 (also known as NgR3) is a GPI-anchored leucine-rich repeat (LRR) protein that functions as part of the NoGo receptor family. The protein consists of:

  • An N-terminal LRR domain

  • Eight LRR repeats

  • A cysteine-rich C-terminal region

  • A GPI anchor domain

The mature mouse Rtn4rl1 protein has a molecular weight of approximately 49 kDa (calculated) but migrates at approximately 65 kDa in SDS-PAGE due to glycosylation . Its primary function appears to be regulating axonal regeneration and plasticity in the adult central nervous system, similar to other family members .

How do the binding properties of Rtn4rl1 compare to other RTN4 receptor family members?

All three RTN4 receptor family members (RTN4R, RTN4RL1, and RTN4RL2) share similar binding domains but exhibit distinct affinities for ligands:

ReceptorPrimary LigandsBinding Affinity RangeKey Binding Domains
RTN4R (NgR1)RTN4/Nogo, MAG, OMgp1.9-30 nMLeucine-rich repeat domain
RTN4RL1 (NgR3)BAI1, BAI35-50 nMLeucine-rich repeat domain
RTN4RL2 (NgR2)MAG10-100 nMLeucine-rich repeat domain

The binding properties differ primarily in their affinity for specific ligands. For example, RTN4R shows the strongest binding to BAI3 (Kd = 1.9 nM), while Rtn4rl1 has intermediate binding affinities to its ligands . These differences likely contribute to their distinct roles in neuronal development and function.

What are the optimal conditions for expressing and purifying recombinant mouse Rtn4rl1?

For successful expression and purification of recombinant mouse Rtn4rl1:

Expression System Options:

  • Mammalian expression (HEK293 cells) yields the most physiologically relevant protein with proper glycosylation

  • E. coli systems can be used for fragments lacking glycosylation sites

Purification Protocol:

  • For His-tagged constructs: Use Ni-NTA affinity chromatography in PBS buffer (pH 7.2-7.4)

  • Include 10% glycerol in storage buffers to maintain stability

  • Consider adding protease inhibitors during lysis to prevent degradation

  • For cell-surface expressed Rtn4rl1, consider using phosphatidylinositol-specific phospholipase C (PI-PLC) to release the GPI-anchored protein

Storage Conditions:

  • Store at -20°C for short term (up to one month)

  • For long-term storage, maintain at -80°C in buffer containing 25 mM Tris-HCl, 100 mM glycine, pH 7.3, with 10% glycerol

  • Avoid repeated freeze-thaw cycles

What detection methods are most effective for studying mouse Rtn4rl1 in different experimental contexts?

Detection MethodSample TypeSensitivitySpecial Considerations
Western BlotCell/tissue lysatesModerate (10-100 ng)Recommended dilution: 1:1000-1:4000
ELISASerum, plasma, cell culture supernatantsHigh (20 pg/ml)Detection range: 20-5000 pg/ml
ImmunohistochemistryFixed tissue sectionsModerateAntigen retrieval may be necessary
ImmunofluorescenceCultured cellsModerate-HighFix with 4% PFA for optimal results
Surface Plasmon Resonance (SPR)Purified proteinVery high (nM range)Ideal for binding affinity studies

When designing experiments:

  • For Western blot applications, reducing conditions may affect epitope recognition; test both reducing and non-reducing conditions

  • For binding studies, consider using SPR or cell-adhesion assays, which have demonstrated high sensitivity for Rtn4rl1 interactions

  • For in vivo studies, consider using Rtn4rl1 knockout models to validate antibody specificity

How do BAI adhesion-GPCRs interact with Rtn4rl1 at the molecular level?

The interaction between BAI adhesion-GPCRs and Rtn4rl1 involves specific structural domains with unusual glycoconjugates mediating high-affinity binding:

Key Interaction Features:

  • The single thrombospondin type 1-repeat (TSR) domain of BAIs binds to the leucine-rich repeat domain of Rtn4rl1 with nanomolar affinity

  • C-mannosylation of tryptophan and O-fucosylation of threonine in the BAI TSR domains are critical for creating the interface that enables high-affinity interactions

Critical Residues:

  • In BAI1: Arg430, Leu420, and Thr424 (O-fucosylation site) are essential for binding

  • In RTN4 receptors: His210, Tyr254, and Arg256 are critical for the interaction

Mutation studies have shown that:

  • The Thr424Val mutation that blocks O-fucosylation of BAI1 abolishes binding

  • The Trp418Phe mutation in BAI1 produces a partial decrease in binding

  • Mutations of critical interface residues (Arg430Ala, Leu420Ala in BAI1; His210Ala, Tyr254Ala, Arg256Ala in RTN4R) abolish complex formation

This molecularly unusual interface represents a new paradigm for protein-protein interactions involving glycoconjugates as essential structural components.

What are the downstream signaling pathways activated by Rtn4rl1 in neurons?

Rtn4rl1 signaling involves several key pathways that regulate neuronal development and function:

  • RhoA Activation Pathway:

    • Rtn4rl1 binding to ligands activates RhoA GTPase

    • Activated RhoA inhibits axonal growth through cytoskeletal reorganization

    • This pathway is shared with other RTN4 receptor family members

  • p75NTR Co-receptor Signaling:

    • Upon ligand binding, RTN4 receptors can interact with p75NTR

    • This interaction sequesters Rho-GDI from Rho, allowing Rho activation

    • Activated Rho suppresses axonal growth and regeneration

  • Synaptic Development Regulation:

    • Interactions between neuronal Rtn4rl1 and neuronal BAIs regulate synapse formation and dendritic arborization

    • Interactions between neuronal Rtn4rl1 and glial BAIs mediate axonal outgrowth

The physiological outcomes of these signaling pathways include:

  • Regulation of dendritic spine morphology

  • Control of synaptic strength

  • Modulation of axonal growth and regeneration

  • Influence on neuronal network activity

How do post-translational modifications affect the function of Rtn4rl1?

Rtn4rl1 undergoes several important post-translational modifications that impact its function:

N-Glycosylation:

  • Mouse Rtn4rl1 contains N-glycosylation at N303

  • Glycosylation contributes to protein folding, stability, and ligand recognition

  • Deglycosylation experiments show that N-glycans contribute to the apparent molecular weight shift from 49 kDa (calculated) to 65 kDa (observed in SDS-PAGE)

Phosphorylation:

  • Phosphorylation sites have been identified at S276, S277, and S278

  • These modifications may regulate protein-protein interactions and signaling

GPI Anchoring:

  • As a GPI-anchored protein, Rtn4rl1 localizes to lipid rafts in the plasma membrane

  • This localization is critical for its function in signaling complexes

Methodological Approach for Studying PTMs:

  • Use site-directed mutagenesis to create point mutations at key modification sites

  • Compare wild-type and mutant protein function in binding assays and cellular models

  • Employ mass spectrometry to identify and quantify specific modifications

  • Use enzymatic treatments (PNGase F for N-glycans, PI-PLC for GPI anchors) to assess the functional impact of specific modifications

What are the phenotypic consequences of Rtn4rl1 deletion in mouse models?

Studies of Rtn4rl1 knockout mice have revealed several important phenotypes:

Neuronal Development:

  • Increased axonal and dendritic arborization

  • Altered synapse formation

  • Changes in neuronal network activity

Electrophysiological Changes:

  • Significant reduction in network activity

  • Decrease in synaptic transmission

  • Alterations in long-term potentiation (LTP) and depression (LTD)

Behavioral Phenotypes:

  • Subtle changes in learning and memory performance

  • Altered response to injury in the central nervous system

Rescue Experiments:
Wild-type Rtn4rl1, but not binding-deficient mutants, can rescue these phenotypes in knockout neurons, highlighting the functional importance of its ligand interactions .

How do the binding properties of recombinant Rtn4rl1 differ from the native protein in neuronal membranes?

PropertyRecombinant Rtn4rl1Native Neuronal Rtn4rl1
GlycosylationDepends on expression system; full in mammalian cellsComplex N-glycans with tissue-specific patterns
Membrane AssociationSoluble unless produced with GPI anchorGPI-anchored in lipid rafts
Co-receptor InteractionsLimited unless co-expressedForms complexes with p75NTR and other co-receptors
Binding AffinityMeasurable by SPR (nanomolar range)May be enhanced by clustering in membrane microdomains
Signaling CapacityLimited unless in cellular contextIntegrated into signaling networks

When designing experiments:

  • Consider using cell membrane preparations rather than soluble proteins for more physiologically relevant binding studies

  • Use techniques like FRET or proximity ligation assays to study interactions in their native context

  • Compare binding properties of recombinant proteins produced in different expression systems to understand the impact of post-translational modifications

How conserved is Rtn4rl1 across different species?

Rtn4rl1 shows significant conservation across mammalian species, with more divergence in non-mammalian vertebrates:

SpeciesSequence Identity to Mouse Rtn4rl1Key Structural Features
Human89%Conserved LRR domain and glycosylation sites
Rat96%Nearly identical binding properties
Elephant Shrew74%Conserved ligand-binding residues
Non-mammalian vertebrates<60%Greater divergence in C-terminal regions

Evolutionary analysis suggests:

  • The core ligand-binding LRR domain is highly conserved across species

  • The greatest sequence divergence occurs in the C-terminal region

  • Glycosylation sites show variable conservation, suggesting species-specific regulation

When designing cross-species experiments:

  • Human antibodies may cross-react with mouse Rtn4rl1 due to high sequence similarity

  • Consider species-specific differences when interpreting binding studies or functional assays

  • The human RTN4RL1 control fragment (aa 279-391) shares 74% sequence identity with the corresponding mouse region

How do the functional properties of Rtn4rl1 compare to other members of the RTN4 receptor family?

PropertyRtn4rl1 (NgR3)RTN4R (NgR1)RTN4RL2 (NgR2)
Primary LigandsBAI adhesion-GPCRsNogo-A, MAG, OMgpMAG
Expression PatternNeuronsNeuronsNeurons
Effect on Axonal GrowthInhibitoryStrongly inhibitoryModerately inhibitory
Role in Synapse FormationRegulatoryRegulatoryRegulatory
Knockout PhenotypeAltered synapse formation and neuronal arborizationMore severe defects in axonal regenerationProtection of motoneurons against apoptosis

All three receptors share structural similarities with leucine-rich repeat domains, but they exhibit distinct ligand binding preferences and functional roles in the nervous system. The combined action of these receptors likely provides redundancy and specificity in regulating neuronal development and regeneration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.