Recombinant Mouse Rhomboid domain-containing protein 2 (Rhbdd2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them during order placement. We will then prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To optimize long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotation at -20°C/-80°C. Our default final glycerol concentration is 50%, which serves as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us and we will prioritize developing your specified tag.
Synonyms
Rhbdd2; Rhbdl7; Rhomboid domain-containing protein 2; Rhomboid-like protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rhbdd2
Target Protein Sequence
MAAPGPASRFWCSCPEVPSATFFTALLSLLVSGPRLFLLQPPLAPSGLSLRSEALRNWQV YRLVTYIFVYENPVSLLCGAIIIWRFAGNFERTVGTVRHCFFTLIFTVFSAIIYLSFESV SSLSKLGEVEDARGFTPVAFAMLGVTSVRSRMRRALVFGVVVPSVLVPWLLLCASWLIPQ TSFLSNVSGLLIGLSYGLTYCYSLDLSERVALKLDQKFPFSLMRRIPLFKYISGSSAERR AAQSRRLNPAPGSYPTQSCHPHLTPSYPVTQMQHASGQKLASWPPGHMPSLPPYQPASGL CYVQNHFGPNPNASSVYPASAGTSQGVQPPSPISCPGTVYSGALGTPGATGSKESSKVAM P
Uniprot No.

Target Background

Gene References Into Functions
  1. RHBDD2 protein plays crucial roles in the development and normal function of the retina PMID: 23386608
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed, including in retina and brain (at protein level), as well as in kidney, testis and ovary. Expressed in all layers of the retina, including inner segments of photoreceptor cells and ganglion cells (at protein level).

Q&A

What is the basic structure and function of RHBDD2?

RHBDD2 is a member of the rhomboid family of integral membrane proteins that are evolutionarily conserved from prokaryotes to eukaryotes. The protein contains a rhomboid domain characteristic of this family, though RHBDD2 belongs to the third phylogenetic class of distantly related rhomboid-like genes for which there is no evidence of active protease functionality .

Unlike classic rhomboid proteins that function as intramembrane serine proteases, RHBDD2's precise molecular mechanism remains to be fully characterized. The protein is thought to be involved in regulated intramembrane proteolysis and subsequent release of functional polypeptides from membrane anchors, with EFNB3 being a known substrate of the human homolog .

Mouse RHBDD2 shares significant sequence homology with human RHBDD2, which has Gene Ontology annotations related to serine-type endopeptidase activity. Current research suggests RHBDD2 may play roles in cellular proliferation and stress response pathways, particularly in the context of pathological conditions.

How is RHBDD2 expression regulated at the transcriptional level?

RHBDD2 expression appears to be regulated by multiple transcription factors, with research indicating that STAT5A and SPI1 are particularly important regulators in certain biological contexts such as sepsis and inflammatory conditions . These transcription factors bind to specific promoter regions to modulate RHBDD2 transcription.

For researchers investigating transcriptional regulation, chromatin immunoprecipitation (ChIP) assays targeting these transcription factors are recommended, coupled with luciferase reporter assays using the RHBDD2 promoter region. When analyzing mouse models, consider that regulatory elements may have species-specific differences despite the conservation of coding sequences.

The methodology for investigating transcriptional regulation should include:

  • Identification of putative transcription factor binding sites through computational analysis

  • Verification of binding through ChIP assays

  • Functional validation through reporter gene assays

  • Expression correlation studies between RHBDD2 and candidate transcription factors

What are the optimal methods for expressing and purifying recombinant mouse RHBDD2?

Expressing and purifying recombinant mouse RHBDD2 presents significant challenges due to its multiple transmembrane domains. The methodological approach should be tailored to your experimental needs:

Expression Systems Comparison:

Expression SystemAdvantagesLimitationsBest For
E. coliCost-effective, high yieldPoor for membrane proteins, lack of post-translational modificationsSoluble domains only
Insect cellsBetter membrane protein folding, some post-translational modificationsModerate cost, longer production timeFull-length protein structural studies
Mammalian cellsNative post-translational modifications, proper foldingExpensive, lower yieldFunctional studies, protein-protein interactions

For full-length mouse RHBDD2, a mammalian expression system (HEK293 or CHO cells) is recommended with a C-terminal tag (His or FLAG) that doesn't interfere with the N-terminal signal sequence. For purification, a two-step approach combining affinity chromatography and size exclusion chromatography in the presence of appropriate detergents (DDM or LMNG) preserves protein functionality.

Critical considerations include:

  • Use of detergent screening to identify optimal solubilization conditions

  • Addition of stabilizing agents during purification

  • Verification of protein folding through circular dichroism or limited proteolysis

  • Functional validation through activity assays

How can I establish and validate RHBDD2 knockdown or knockout models in mice?

When developing RHBDD2 genetic models in mice, consider both conventional and conditional approaches:

Knockdown Strategy:
siRNA or shRNA approaches targeting RHBDD2 mRNA can be effective for transient studies. Based on published research with human RHBDD2, design multiple siRNA sequences targeting conserved regions and validate knockdown efficiency by RT-PCR and western blotting . The research by Abba et al. demonstrated that siRNA-mediated silencing of RHBDD2 resulted in decreased proliferation of breast cancer cells, suggesting a functional approach to validation .

Knockout Strategy:
For permanent genetic models, CRISPR-Cas9 is currently the most efficient approach. Design guide RNAs targeting early exons of mouse RHBDD2, preferably exons that are present in all known splice variants. Validate knockouts through sequencing, RT-PCR, and western blotting.

Validation Methodologies:

  • Molecular validation: Genomic PCR, RT-PCR, western blotting

  • Phenotypic validation: Given RHBDD2's links to proliferation, assess cell growth rates in primary cells

  • Functional rescue: Reintroduce wild-type RHBDD2 to confirm phenotype specificity

  • Comparative analysis: Analyze phenotypes against known RHBDD2-related pathways

What is the role of RHBDD2 in cancer progression and how can it be studied in mouse models?

RHBDD2 has been implicated in cancer progression, particularly in breast cancer. Human studies have shown RHBDD2 overexpression in breast carcinomas, with gene amplification detected in 21% of invasive breast carcinomas . High RHBDD2 expression is associated with poor prognosis in ER-negative breast carcinomas .

For studying RHBDD2 in mouse cancer models, consider these methodological approaches:

  • Genetically Engineered Mouse Models (GEMMs):

    • Develop RHBDD2-overexpressing transgenic mice under tissue-specific promoters

    • Create RHBDD2 conditional knockout mice using Cre-loxP systems

    • Cross these models with established cancer models (e.g., MMTV-PyMT for breast cancer)

  • Xenograft Models:

    • Establish cell lines with modulated RHBDD2 expression (overexpression, knockdown)

    • Inject modified cells into immunocompromised mice

    • Monitor tumor growth, invasion, and metastasis

  • Analysis Methods:

    • Immunohistochemistry to assess RHBDD2 protein levels in tumor tissues

    • RNA-seq for transcriptomic changes associated with RHBDD2 modulation

    • Functional assays for proliferation, apoptosis, and invasion

    • In vivo imaging for real-time tumor progression tracking

The research by Abba et al. showed that siRNA-mediated silencing of RHBDD2 decreased proliferation of breast cancer cells, suggesting that RHBDD2 inhibition might be a potential therapeutic approach . This can be recapitulated in mouse models to validate therapeutic potential.

How is RHBDD2 involved in inflammatory conditions such as sepsis?

Recent research has identified RHBDD2 as a potential biomarker in sepsis and septic shock. Studies have shown that RHBDD2 is overexpressed in these conditions and appears to be regulated by STAT5A and SPI1 transcription factors .

To investigate RHBDD2's role in inflammatory conditions in mouse models:

  • Sepsis Models:

    • Lipopolysaccharide (LPS) injection

    • Cecal ligation and puncture (CLP)

    • Pneumonia models with bacterial infection

  • Analysis Approaches:

    • Temporal expression profiling of RHBDD2 during disease progression

    • Correlation with inflammatory markers and cytokines

    • Impact of RHBDD2 modulation on disease outcomes

    • Signaling pathway analysis focusing on STAT5A and SPI1 pathways

Gene enrichment analysis of RHBDD2 co-expressed genes showed involvement in infection-related pathways and biological functions associated with sepsis and septic shock . This suggests RHBDD2 may play an important role in the inflammatory cascade during infection.

Which signaling pathways does RHBDD2 interact with and how can these be investigated?

RHBDD2's signaling interactions remain incompletely characterized, but several pathways have been implicated through co-expression and functional studies:

  • ER Stress Pathways:
    RHBDD2 has been associated with ER stress responses . To investigate this connection:

    • Induce ER stress with tunicamycin or thapsigargin in RHBDD2-modulated cells

    • Assess UPR markers (CHOP, BiP, XBP1 splicing) in relation to RHBDD2 expression

    • Perform co-immunoprecipitation to identify ER stress-related binding partners

  • Cell Proliferation Signaling:
    siRNA studies have demonstrated RHBDD2's role in regulating proliferation . Research approaches include:

    • Analysis of cell cycle regulators in RHBDD2-modulated cells

    • Phosphorylation status of key proliferation-related kinases (ERK, AKT)

    • BrdU incorporation and Ki-67 staining to measure proliferation rates

  • Inflammatory Signaling:
    RHBDD2's link to sepsis suggests involvement in inflammatory pathways :

    • Assess NF-κB pathway activation in relation to RHBDD2 expression

    • Measure cytokine production in RHBDD2-modulated systems

    • Investigate STAT signaling, given STAT5A's role in RHBDD2 regulation

For comprehensive pathway analysis, a combination of phosphoproteomics, transcriptomics, and targeted signaling assays is recommended in both normal and RHBDD2-modulated cellular contexts.

What are the known protein-protein interactions of RHBDD2 and how do they affect its function?

Limited information exists on RHBDD2's protein-protein interactions, although research on human RHBDD2 indicates it may interact with ephrin B3 (EFNB3) as a substrate . To investigate mouse RHBDD2 interactions:

Recommended Methodological Approaches:

  • Identification of Interacting Partners:

    • Proximity labeling techniques (BioID, APEX)

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Protein microarrays

  • Validation and Characterization:

    • Bimolecular Fluorescence Complementation (BiFC)

    • Förster Resonance Energy Transfer (FRET)

    • Mutational analysis of interaction domains

    • Functional assays to assess the impact of disrupting specific interactions

  • Subcellular Localization:

    • Immunofluorescence microscopy to determine co-localization

    • Fractionation studies to identify compartment-specific interactions

    • Live-cell imaging to track dynamic interactions

When designing these experiments, consider RHBDD2's membrane localization, which may require specialized approaches for interaction studies, such as membrane yeast two-hybrid systems or detergent-compatible co-immunoprecipitation protocols.

What are the known splice variants of mouse RHBDD2 and how do they differ functionally?

Research on human RHBDD2 has identified at least two alternatively spliced mRNA isoforms . For mouse RHBDD2, similar alternative splicing patterns may exist:

Methodological Approaches to Identify and Characterize Isoforms:

  • Identification:

    • RT-PCR with primers spanning potential splice junctions

    • RNA-Seq analysis with splice-aware aligners

    • 5' and 3' RACE to identify alternative transcription start sites and termination sites

  • Quantification:

    • Isoform-specific qPCR assays

    • Digital droplet PCR for absolute quantification

    • NanoString technology for multiplexed detection

  • Functional Characterization:

    • Expression of individual isoforms in cellular models

    • Domain-specific functional assays

    • Subcellular localization studies

    • Protein-protein interaction comparison between isoforms

Human studies using RT-PCR with specific primer pairs have successfully identified RHBDD2 isoforms in breast cancer cell lines . A similar approach can be applied to mouse tissues and cell lines, with sequence verification of PCR products to confirm isoform identity.

How does tissue-specific expression of RHBDD2 vary across mouse development and in different pathological states?

Understanding the expression pattern of RHBDD2 across tissues and developmental stages provides important context for functional studies:

Methodological Approaches:

  • Developmental Expression Profiling:

    • Quantitative RT-PCR across embryonic and postnatal stages

    • In situ hybridization for spatial resolution

    • Immunohistochemistry with developmental tissue arrays

    • Single-cell RNA-seq for cell-type specific expression

  • Pathological State Analysis:

    • Compare expression in normal versus disease models

    • Correlate expression with disease progression markers

    • Assess isoform-specific expression changes in disease

  • Regulatory Analysis:

    • Examine promoter usage across tissues using 5' RACE

    • Assess epigenetic modifications of the RHBDD2 locus

    • Identify tissue-specific transcription factors

When conducting these studies, it's important to use isoform-specific detection methods when possible, as tissue-specific expression patterns may differ between isoforms. Additionally, single-cell approaches can reveal cell type-specific expression that might be masked in bulk tissue analysis.

What are the common technical challenges when working with recombinant mouse RHBDD2 and how can they be overcome?

Working with RHBDD2 presents several technical challenges common to membrane proteins:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for expression system, use strong inducible promoters, and consider fusion tags that enhance expression (MBP, SUMO)

  • Validation: Compare expression levels using western blotting across different constructs and conditions

Challenge 2: Protein Aggregation

  • Solution: Screen multiple detergents and solubilization conditions, consider amphipols or nanodiscs for membrane protein stabilization

  • Validation: Size exclusion chromatography to assess monodispersity, negative stain EM to verify particle homogeneity

Challenge 3: Loss of Function During Purification

  • Solution: Develop activity assays to monitor function throughout purification, minimize time between extraction and final storage

  • Validation: Compare activity of protein at each purification step, optimize buffer components to maintain activity

Challenge 4: Antibody Specificity Issues

  • Solution: Validate antibodies against knockout controls, use multiple antibodies targeting different epitopes

  • Validation: Peptide competition assays, parallel detection with tagged recombinant proteins

For functional studies, consider using cell-based assays where RHBDD2 remains in its native environment until immediately before analysis, minimizing handling-related artifacts.

How can conflicting results in RHBDD2 research be reconciled through improved experimental design?

Conflicting results in RHBDD2 research may arise from several sources, including isoform differences, context-dependent functions, or technical variations:

Methodological Approaches to Reconcile Discrepancies:

  • Standardize Experimental Systems:

    • Use identical cell lines, animal strains, and reagents where possible

    • Document passage numbers for cell lines and age/sex for animal models

    • Establish standard operating procedures for key techniques

  • Comprehensive Isoform Analysis:

    • Always specify which isoform(s) are being studied

    • Consider the possibility that different isoforms have distinct functions

    • Design experiments to test isoform-specific effects

  • Context-Dependent Function Assessment:

    • Test RHBDD2 function across multiple cell types/tissues

    • Vary experimental conditions (stress, growth factors, etc.)

    • Consider microenvironmental factors that might influence results

  • Meta-Analysis Approach:

    • Systematically review published methodologies

    • Replicate key experiments with multiple methodologies

    • Perform statistical analysis across studies to identify consistent findings

  • Collaborative Cross-Validation:

    • Establish collaborations between labs with conflicting results

    • Exchange materials and protocols

    • Perform blinded analyses to minimize bias

When designing experiments to resolve conflicts, include appropriate positive and negative controls, adequate biological replicates, and robust statistical analyses to ensure the reliability and reproducibility of findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.