Recombinant Mouse Rhomboid domain-containing protein 3 (Rhbdd3)

Shipped with Ice Packs
In Stock

Description

Biological Functions

Rhbdd3 exhibits multifaceted roles in cellular and immune processes:

  • Immune regulation: Acts as a negative feedback regulator of Toll-like receptor 3 (TLR3)-mediated natural killer (NK) cell activation .

  • Apoptosis modulation: Originally identified as a pituitary tumor apoptosis gene (PTAG), with reduced expression in colorectal and pituitary tumors .

  • Protein interactions: Binds DNAX activation protein of 12 kDa (DAP12), promoting its proteasomal degradation to inhibit MAPK signaling .

Key Research Findings

Studies using Rhbdd3-deficient (Rhbdd3⁻/⁻) mice reveal critical insights:

ParameterWild-Type (Rhbdd3⁺/⁺)Rhbdd3⁻/⁻Mechanism
IFN-γ productionBasal levelsElevated (TLR3 stimulation) Reduced DAP12 degradation → Enhanced MAPK
Granzyme B expressionLowHigh Loss of NK cell suppression
NK cell accumulationLimitedIncreased (liver) Disrupted NK-Kupffer cell interactions

Mechanistic highlights:

  • Rhbdd3 inhibits TLR3-triggered NK cell activation via cell-contact-dependent interactions with dendritic and Kupffer cells .

  • Promotes DAP12 degradation, reducing downstream MAPK (p-ERK, p-JNK, p-p38) activation .

Interaction Partners and Pathways

Rhbdd3 interacts with proteins involved in immune signaling and proteolysis:

PartnerFunctionInteraction Evidence
DAP12Adaptor for NK cell-activating receptorsCo-immunoprecipitation
RHBDL1Regulated intramembrane proteolysisPredicted (STRING)
UBAC2Modulates FAF2 trafficking and Wnt signalingPredicted (STRING)
RHBDD1ER-associated degradation of misfolded proteinsHomology (STRING)

Applications in Research

Rhbdd3 is utilized in:

  • Functional studies: Recombinant proteins enable in vitro assays for protease activity or interaction mapping .

  • ELISA-based quantification: Kits (e.g., Abexa) measure endogenous Rhbdd3 levels in tissues or lysates .

  • Therapeutic exploration: Overexpression in tumor models induces apoptosis, suggesting potential for cancer treatment .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rhbdd3; Rhomboid domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rhbdd3
Target Protein Sequence
MHAWEAPGSLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLMEPWQVHRLLTHALGH TALPGLLLSLLLLPTLGWWQECHLGTVRFLHNSTVLALATGLLAVLLAGLGVSGAAGGCG YMPVHLAMLAGQSHHPGWPQRTLPPWLLPWLLLALTLLLSSEPPFLQLLCGLLTGLAYAA GAFQWLELSEQRLQVLQEGVLCKSLARCWPLRLFPTPGSLGELPVTYPAGVRPATPRPPY LASSDSWPHSDGSAQLPPRLGPGQLTWKNSERGLDWAGSSFASATTMWAALDEQMLQEGI QASLLDVSVQGSQSSLWLPKPSVSSLRLQQLQHMGFPTEQAAVALAATGRVEGAVSLLVE GLVDTEALVTEGRSSPAHCTGTGAS
Uniprot No.

Target Background

Gene References Into Functions
  1. Rhbdd3, a rhomboid protease, has been reported to suppress dendritic cell activation and interleukin-6 (IL-6) production induced by Toll-like receptors (PMID: 24859449).
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of mouse Rhbdd3?

Rhbdd3 is a protein belonging to the rhomboid domain-containing family, with a molecular weight of approximately 40.5 kDa. The protein contains a rhomboid domain characteristic of intramembrane serine proteases. Functionally, Rhbdd3 primarily acts as a negative regulator of Toll-like receptor 3 (TLR3)-mediated natural killer (NK) cell activation in a feedback manner. It exhibits serine-type endopeptidase activity and is predicted to be located in cellular membranes .

Research methodologically confirms that Rhbdd3:

  • Inhibits TLR3-triggered IFN-γ and granzyme B expression in NK cells

  • Promotes the degradation of DNAX activation protein of 12 kDa (DAP12)

  • Attenuates MAPK cascade activation

  • Regulates cell-cell interactions between NK cells and accessory cells (dendritic cells and Kupffer cells)

How is Rhbdd3 expressed in immune cells and what regulates its expression?

Time-course expression studies reveal:

  • Rhbdd3 increases rapidly in NK cells after in vivo injection of poly(I:C)

  • The selective upregulation creates a negative feedback loop for TLR3-mediated NK cell activation

  • This expression pattern suggests Rhbdd3 functions as a regulatory checkpoint specifically in TLR3-triggered immune responses

What are the optimal methods for generating and validating Rhbdd3-deficient mouse models?

To generate valid Rhbdd3-deficient mouse models, researchers should consider the following methodological approach:

  • Target the Rhbdd3 gene through homologous recombination to ensure complete gene knockout

  • Validate knockout efficiency through:

    • Western blot analysis of Rhbdd3 protein expression

    • RT-PCR for mRNA expression

    • Genomic DNA sequencing to confirm deletion

For experimental validity, researchers should confirm that:

  • The distributions of B cells, T cells, NK cells, and myeloid cells remain comparable between Rhbdd3+/+ and Rhbdd3−/− mice, indicating Rhbdd3 does not affect the development of these immune cells

  • The knockout model specifically affects Rhbdd3-dependent functions without causing developmental anomalies

What experimental design approaches are most effective for studying Rhbdd3's role in NK cell activation?

An effective experimental design for investigating Rhbdd3's role in NK cell activation should incorporate:

  • Comparative analysis using knockout models:

    • Compare cytokine production (IFN-γ, IL-6) between Rhbdd3+/+ and Rhbdd3−/− splenocytes upon poly(I:C) stimulation

    • Assess intracellular expression of granzyme B, perforin, and IFN-γ in NK1.1+ cells

  • In vivo and ex vivo approaches:

    • Challenge mice with poly(I:C) and analyze liver NK cells for effector molecule expression

    • Measure NK cell cytotoxicity against target cells (e.g., YAC-1 cells)

  • Cell-cell interaction studies:

    • Use Transwell systems to determine if Rhbdd3's effects require direct cell contact

    • Co-culture experiments with dendritic cells or Kupffer cells to assess accessory cell requirements

  • Signaling pathway analysis:

    • Examine MAPK activation (p-ERK, p-JNK, p-p38) in NK cells from Rhbdd3+/+ and Rhbdd3−/− mice

How does Rhbdd3 interact with DAP12, and what methodologies best capture this interaction?

Rhbdd3 interacts with DNAX activation protein of 12 kDa (DAP12), a key intracellular accessory adaptor of several activating receptors on NK cells. This interaction can be methodologically investigated through:

  • Co-localization studies:

    • Confocal microscopy reveals that DAP12 and Rhbdd3 increase and aggregate significantly after poly(I:C) stimulation

  • Co-immunoprecipitation analysis:

    • Demonstrates direct interaction between Rhbdd3 and DAP12 in poly(I:C)-activated NK cells

  • Protein degradation assays:

    • Proteasome inhibitor (MG132) pretreatment increases DAP12 expression in Rhbdd3−/− NK cells but not in Rhbdd3+/+ NK cells

    • Western blot analysis shows that Rhbdd3 knockdown or depletion significantly elevates DAP12 protein levels but not mRNA levels after TLR3 stimulation

These findings indicate that Rhbdd3 promotes proteasomal degradation of DAP12, thereby inhibiting TLR3-triggered DAP12 expression and subsequent signaling pathways.

What signaling pathways does Rhbdd3 regulate in NK cells and how can they be experimentally validated?

Rhbdd3 primarily regulates MAPK signaling pathways in NK cells. Experimental validation of these pathways should include:

  • Western blot analysis of phosphorylated signaling molecules:

    • p-ERK, p-JNK, and p-p38 levels are significantly higher in Rhbdd3−/− NK cells than Rhbdd3+/+ NK cells after TLR3 stimulation in the presence of dendritic cells

    • Similar activation patterns are observed in Rhbdd3−/− splenic NK cells after in vivo poly(I:C) stimulation

  • Pharmacological inhibition of specific pathways to confirm their involvement:

    • MAPK inhibitors should reverse the enhanced NK cell activation in Rhbdd3−/− cells

  • Reporter assays to assess transcription factor activation downstream of these pathways

Interestingly, while MAPK pathways show enhanced activation in Rhbdd3−/− NK cells, NF-κB activation remains comparable between Rhbdd3−/− and Rhbdd3+/+ NK cells, suggesting specificity in Rhbdd3's regulatory effects .

How does Rhbdd3 deficiency affect TLR3-triggered acute inflammation, and what parameters should be measured?

Rhbdd3 deficiency exacerbates TLR3-triggered acute inflammation, particularly in the liver. Comprehensive assessment should include:

  • Serum biomarkers of liver damage:

    • Alanine transaminase (ALT)

    • Aspartate transaminase (AST)

  • Inflammatory cytokine levels:

    • IFN-γ

    • IL-6

  • Histopathological analysis:

    • Liver inflammatory infiltrates

    • Tissue necrosis

  • Survival assessment:

    • Monitoring accelerated death in Rhbdd3−/− mice following poly(I:C) injection

Experimental data shows that Rhbdd3−/− mice exhibit:

  • More exaggerated elevation of serum ALT, AST, IFN-γ, and IL-6 than Rhbdd3+/+ mice after poly(I:C) injection

  • Significant increases in inflammatory infiltrates and necrosis in liver tissue

  • More IL-6 in liver tissue

  • Accelerated death after poly(I:C) challenge

What experimental approaches can determine if the inflammatory phenotype in Rhbdd3-deficient mice is NK cell-dependent?

To determine if the inflammatory phenotype in Rhbdd3-deficient mice is NK cell-dependent, researchers should employ the following approaches:

  • NK cell depletion studies:

    • Deplete NK cells using anti-NK1.1 antibodies in Rhbdd3−/− and Rhbdd3+/+ mice

    • Challenge with poly(I:C) and measure inflammatory parameters

    • Data indicates that NK cell depletion reverses the exacerbated inflammatory response and survival deficit in Rhbdd3−/− mice

  • Adoptive transfer experiments:

    • Transfer Rhbdd3+/+ or Rhbdd3−/− NK cells into NK cell-depleted mice

    • Challenge with poly(I:C) and measure ALT, AST, IFN-γ, and IL-6 levels

    • Results show that mice receiving Rhbdd3−/− NK cells develop more severe inflammation than those receiving Rhbdd3+/+ NK cells

  • Kupffer cell interaction studies:

    • Deplete Kupffer cells with clodronate liposomes in Rhbdd3+/+ and Rhbdd3−/− mice

    • Challenge with poly(I:C) and measure ALT levels

    • Findings demonstrate that Kupffer cell depletion reduces poly(I:C)-induced ALT in both genotypes to similar levels, confirming Rhbdd3's role in regulating NK cell-Kupffer cell interactions

How might recombinant Rhbdd3 protein be used to develop therapeutic strategies for inflammatory conditions?

Recombinant Rhbdd3 protein holds significant therapeutic potential based on its negative regulatory role in inflammation. Methodological approaches to develop Rhbdd3-based therapeutics should consider:

  • Protein engineering strategies:

    • Identify the minimal functional domain of Rhbdd3 required for its immunoregulatory effects

    • Develop cell-penetrating Rhbdd3 variants that can enter NK cells efficiently

    • Create fusion proteins combining Rhbdd3 with targeting moieties specific for NK cells

  • Delivery systems development:

    • Design nanoparticle-based delivery systems for recombinant Rhbdd3

    • Target these delivery systems to sites of inflammation

  • Efficacy testing in models of inflammatory diseases:

    • TLR3-mediated hepatitis models

    • Viral infection models where TLR3 signaling contributes to pathology

    • Autoimmune conditions with aberrant NK cell activation

  • Potential therapeutic mechanisms:

    • Promotion of DAP12 degradation

    • Inhibition of MAPK signaling pathways

    • Disruption of pathogenic interactions between NK cells and accessory cells

What methodological approaches can resolve contradictory findings about Rhbdd3's role in different immune contexts?

To address potentially contradictory findings about Rhbdd3's immunoregulatory roles, researchers should implement:

  • Context-specific analysis:

    • Compare Rhbdd3 functions in different immune cell types (NK cells vs. T cells vs. myeloid cells)

    • Analyze Rhbdd3 effects under different stimulation conditions (TLR3 vs. other TLRs vs. cytokine stimulation)

    • Assess tissue-specific roles (liver vs. spleen vs. other organs)

  • Temporal regulation studies:

    • Perform time-course analyses of Rhbdd3 expression and function

    • Use inducible knockout systems to distinguish between developmental and functional roles

  • Single-cell analysis approaches:

    • Employ single-cell RNA sequencing to identify cell-specific effects

    • Use mass cytometry to characterize signaling pathway differences

  • Comprehensive interaction mapping:

    • Beyond DAP12, identify other Rhbdd3 interaction partners

    • Use proximity labeling approaches like BioID or APEX to map the complete Rhbdd3 interactome

  • Integration of multi-omics data:

    • Combine transcriptomic, proteomic, and phosphoproteomic analyses

    • Develop computational models to predict context-dependent Rhbdd3 functions

What are the optimal expression systems for producing recombinant mouse Rhbdd3 with preserved functional activity?

For producing functionally active recombinant mouse Rhbdd3, researchers should consider the following expression systems and methodological approaches:

  • Mammalian expression systems:

    • HEK-293 cells have been successfully used to express recombinant human RHBDD3

    • For mouse Rhbdd3, consider mouse cell lines (NIH/3T3) or other mammalian systems that ensure proper post-translational modifications

  • Cell-free protein synthesis:

    • Has been employed for producing both human and mouse RHBDD3

    • Allows for rapid production and avoids potential toxicity issues

  • Purification strategies:

    • Affinity tags (His, Strep) facilitate purification while minimizing impact on function

    • Size exclusion chromatography ensures homogeneity of the final product

  • Quality assessment methods:

    • SDS-PAGE (>90% purity)

    • Western blot analysis

    • Analytical SEC (HPLC)

    • Anti-tag ELISA

  • Functional validation approaches:

    • In vitro protease activity assays

    • DAP12 interaction studies

    • Cell-based assays measuring inhibition of NK cell activation

What critical experimental controls are necessary when studying the effects of recombinant Rhbdd3 on immune cell functions?

When studying recombinant Rhbdd3's effects on immune cell functions, implement these critical experimental controls:

  • Protein quality controls:

    • Heat-inactivated Rhbdd3 to confirm enzymatic activity is required for observed effects

    • Mutant Rhbdd3 variants (e.g., catalytically inactive mutants) to distinguish between enzymatic and scaffold functions

    • Empty vector-produced protein preparations to control for contaminants

  • Cell system controls:

    • Include Rhbdd3-deficient cells to establish baseline responses

    • Compare effects on multiple cell types (NK cells, T cells, etc.) to determine specificity

    • Test both resting and activated immune cells

  • Signaling pathway validation:

    • Include MAPK inhibitors to confirm pathway specificity

    • Compare with known regulators of the same pathways

    • Validate key observations with both recombinant protein and genetic approaches (knockout/knockdown)

  • Dose-response relationships:

    • Test multiple concentrations to establish physiologically relevant dosing

    • Compare with estimated endogenous Rhbdd3 levels

  • Timing considerations:

    • Perform time-course experiments to capture both immediate and delayed effects

    • Pre-treat versus post-stimulation addition to distinguish preventive from therapeutic effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.