Recombinant Mouse Ribonuclease kappa (Rnasek)

Shipped with Ice Packs
In Stock

Description

1.1. Sequence and Conservation

RNASEK is a 98-amino acid protein (UniProt ID: Q8K3C0) with a His-tag appended for purification. Its sequence shares 100% identity with mammalian orthologs, including human RNASEK . Key features include:

FeatureDetail
Amino Acid SequenceMASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYNLYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR
Molecular Weight~11 kDa (predicted)
Expression SystemE. coli (commonly used for recombinant production)
Purification TagN-terminal His-tag (6xHis)

1.2. Catalytic Activity

RNASEK exhibits endoribonuclease activity, preferentially cleaving ApU and ApG phosphodiester bonds. It hydrolyzes UpU bonds at lower efficiency . This specificity distinguishes it from RNase A family enzymes, which target pyrimidines .

2.1. Viral Entry and Endocytosis

RNASEK is essential for the internalization of acid-dependent viruses:

Virus FamilyMechanismEvidence
FlaviviridaeFacilitates clathrin-mediated endocytosis (CME)Required for dengue, West Nile, and Rift Valley Fever virus entry
OrthomyxoviridaeInteracts with viral structural proteins (e.g., influenza hemagglutinin)Depletion blocks viral uptake without affecting general endocytosis
CoronaviridaeBinds PEDV spike (S), envelope (E), and membrane (M) proteinsPromotes CME via clathrin-EPS15 complex formation

2.2. Cellular Processes

3.1. Virology Studies

RNASEK is a critical tool for investigating viral entry mechanisms:

ApplicationMethodOutcome
Viral InternalizationsiRNA knockdown or CRISPR depletion in cell linesBlocks CME-dependent viral entry (e.g., influenza, PEDV)
Protein InteractionCo-immunoprecipitation (Co-IP) with viral envelope proteinsIdentifies RNASEK-EPS15-clathrin complexes in CME

3.2. Immune Response Studies

While not directly studied in mice, RNASEK homologs in fish enhance type I interferon (IFN) production, suggesting immunomodulatory potential .

4.1. Recombinant Protein Suppliers

SupplierProductKey Features
Creative BiomartRecombinant Full-Length Mouse RNASEK (Q8K3C0, His-tagged)Expressed in E. coli, 1-98aa sequence, 50 µg/vial
GeneBioSystemsRecombinant Human RNASEK (Q6P5S7)Cross-reacts with mouse due to 100% conservation; used for antibody blocking
Thermo FisherRNASEK Control Fragment (aa 76-105)For antibody validation; 100% mouse homology

4.2. Expression and Purification

  • Expression: E. coli BL21(DE3) cells are commonly used for high-yield production .

  • Purification: Nickel affinity chromatography (via His-tag) followed by gel filtration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with blue ice packs by default. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Rnasek; D11Bwg0434e; Ribonuclease kappa; RNase K; RNase kappa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rnasek
Target Protein Sequence
MASLLCCGPKLAACGIVLSAWGVIMLIMLGIFFNVHSAVLIEDVPFTEKDFENGPQNIYN LYEQVSYNCFIAAGLYLLLGGFSFCQVRLNKRKEYMVR
Uniprot No.

Target Background

Function

Recombinant Mouse Ribonuclease kappa (RNaseK) is an endoribonuclease that preferentially cleaves ApU and ApG phosphodiester bonds. It hydrolyzes UpU bonds at a lower rate.

Database Links

KEGG: mmu:52898

UniGene: Mm.29852

Protein Families
RNase K family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is mouse Ribonuclease kappa and how does it differ from other ribonucleases?

Mouse Ribonuclease kappa (Rnasek) is a small endoribonuclease consisting of approximately 98 amino acids that belongs to the highly conserved RNase κ family. Unlike members of the RNase A family, RNase κ shows no significant sequence homology to other known ribonucleases and possesses distinct substrate specificity. The protein exhibits extremely high conservation rates among mammals (>98% identity), suggesting crucial biological functions . RNase κ preferentially cleaves ApU and ApG phosphodiester bonds, while hydrolyzing UpU bonds at a lower rate . Additionally, RNase κ is completely resistant to placental ribonuclease inhibitor, further distinguishing it from the RNase A family .

What is the genomic organization and expression pattern of mouse Rnasek?

Mouse Rnasek is encoded by a single-copy gene that shows widespread expression across various tissues and developmental stages. The gene is highly conserved among metazoans from C. elegans to humans, with no representatives detected in yeast, plants, or bacteria . The extraordinary level of conservation (>98% among mammals) is comparable only to other protein families with critical biological roles, such as histones or phosphofructokinase . This ubiquitous expression pattern suggests fundamental biological importance rather than tissue-specific functions.

What is the role of Rnasek in piRNA biogenesis?

Rnasek plays a crucial role in piRNA (PIWI-interacting RNA) biogenesis by generating 2′,3′-cyclic phosphate-containing piRNA precursors (cP-RNAs) . Studies in Bombyx mori (silkworm) have shown that RNase κ is a mitochondria-associated endoribonuclease that produces these cP-RNAs, which are directly utilized as piRNA precursors . These cP-RNAs containing 5′-phosphate (P-cP-RNAs) exhibit highly consistent 5′-end positions as the mature piRNAs and are loaded onto PIWI proteins . The depletion of RNase κ in Bombyx resulted in elevated transposon levels and disrupted piRNA-mediated sex determination in embryos, highlighting its essential role in both piRNA biogenesis and embryonic development .

How does Rnasek contribute to cellular RNA metabolism?

Rnasek appears to have significant roles in RNA metabolism beyond piRNA biogenesis, though its precise functions are still being elucidated. The enzyme's high conservation across species and widespread expression suggest fundamental roles in RNA processing and regulation. Its specific cleavage preferences for certain phosphodiester bonds (ApU and ApG) indicate selective RNA substrate targeting . The RNase κ family likely participates in essential RNA degradation pathways that affect gene expression or translational control, potentially influencing cell differentiation and development. Additionally, like other ribonucleases, Rnasek may have roles beyond simple RNA digestion, possibly acting as a messenger molecule by interacting with cellular components such as actin, heparin, and proteoglycans .

What phenotypes result from Rnasek knockout or depletion?

Depletion of RNase κ has demonstrated significant biological consequences. In Bombyx, RNase κ-depletion resulted in elevated transposon levels and disrupted piRNA-mediated sex determination in embryos . This indicates that RNase κ is essential for transposon silencing via the piRNA pathway and plays critical roles in normal embryonic development. While specific mouse knockout phenotypes are not explicitly detailed in the provided search results, the extreme conservation of this enzyme across species suggests that disruption of Rnasek function in mice would likely result in significant developmental abnormalities or embryonic lethality. The connection to piRNA pathways also suggests potential impacts on germline development and fertility if Rnasek function is compromised .

What expression systems are effective for producing recombinant mouse Rnasek?

Based on experiences with the human ortholog, the methylotrophic yeast Pichia pastoris expression system has proven effective for producing functional recombinant RNase κ . Attempts to express human RNase κ in prokaryotic systems (E. coli) using various vectors (pET 15b, pET 20b, pET 29b, pET 39b, pET coco-1, pSCREEN-1b(+)) caused severe toxic effects to the host cells, suggesting that the enzyme's ribonucleolytic activity may interfere with bacterial RNA metabolism . In contrast, the P. pastoris system allowed for successful expression and secretion of active recombinant protein. For mouse Rnasek, a similar approach would likely be successful, utilizing the pPICZα vector with α-factor secretion signal to facilitate secretion of the recombinant protein into the culture medium .

What purification strategies yield high-quality recombinant mouse Rnasek?

For effective purification of recombinant mouse Rnasek, a strategy similar to that used for human RNase κ would be recommended. This typically involves:

  • Expression as a fusion protein with affinity tags (such as His-tag and c-myc epitope) at the C-terminus to facilitate purification.

  • Secretion of the recombinant protein into the culture medium using appropriate secretion signals.

  • Affinity chromatography (e.g., metal affinity chromatography for His-tagged proteins) for initial purification.

  • Further purification steps may include ion-exchange chromatography and size-exclusion chromatography to achieve high purity.

  • Activity-based purification steps might be employed to select for functionally active enzyme.

For verification of successful expression, western blot analysis using anti-tag antibodies (e.g., anti-His-tag) can be performed, along with functional assays to confirm ribonucleolytic activity .

What are the common challenges in producing active recombinant Rnasek and how can they be overcome?

Several challenges may arise when producing recombinant Rnasek:

  • Toxicity to host cells: As observed with human RNase κ in prokaryotic systems, the enzyme's ribonucleolytic activity can be toxic to the host cells . This can be overcome by:

    • Using eukaryotic expression systems like P. pastoris that appear to tolerate the expression better.

    • Employing tightly regulated expression systems with inducible promoters.

    • Expressing the protein with secretion signals to direct it out of the cell.

  • Protein folding and stability: Ensuring proper folding of the recombinant protein is crucial. Approaches include:

    • Optimizing expression temperature (lower temperatures often favor proper folding).

    • Adding stabilizing agents during purification.

    • Using fusion tags that enhance solubility.

  • Verification of activity: Confirming that the purified recombinant protein retains enzymatic activity. Methods include:

    • Using defined RNA substrates to test the enzyme's specific cleavage patterns.

    • Comparing activity against known preferences (e.g., ApU and ApG phosphodiester bonds) .

What are the optimal conditions for measuring mouse Rnasek enzymatic activity?

Based on studies with the human ortholog, optimal conditions for measuring mouse Rnasek activity would likely include:

  • pH: Slightly acidic to neutral pH range (approximately pH 6.0-7.5) is typically optimal for ribonuclease activity.

  • Temperature: 37°C is appropriate for mammalian enzymes under physiological conditions.

  • Buffer composition: A buffer system containing appropriate ionic strength (e.g., 50-100 mM salt) and possibly divalent cations.

  • Substrate: Synthetic RNA oligonucleotides containing the preferred cleavage sites (ApU and ApG) would be ideal for specific activity measurements. Human RNase κ was characterized using a 30-mer 5′-end-labeled RNA probe .

  • Reaction time: Depending on enzyme concentration, reactions may require 15-60 minutes for measurable product formation.

Activity can be monitored by detecting cleavage products through methods such as denaturing gel electrophoresis of labeled substrates or HPLC analysis of reaction products .

How does substrate sequence specificity affect Rnasek activity?

Rnasek demonstrates clear sequence preferences in its cleavage activity. The human ortholog preferentially cleaves ApU and ApG phosphodiester bonds, while hydrolyzing UpU bonds at a lower rate . This sequence specificity is likely conserved in mouse Rnasek due to the high conservation of the enzyme across mammalian species.

To determine the precise substrate preferences of mouse Rnasek:

  • Synthetic RNA oligonucleotides with various dinucleotide combinations can be used as substrates.

  • Cleavage products can be analyzed to map exact cleavage sites.

  • Quantitative comparisons of cleavage rates for different sequences can establish a hierarchy of preference.

This sequence specificity has important implications for the enzyme's biological functions, as it would determine which RNA molecules or regions within RNA molecules are susceptible to cleavage in vivo. For example, in the context of piRNA biogenesis, this specificity may help define which transcripts become processed into piRNA precursors .

What methods can be used to monitor Rnasek-mediated cleavage products?

Several analytical methods can be employed to monitor and characterize Rnasek-mediated RNA cleavage:

  • Gel electrophoresis: Using denaturing polyacrylamide gels to separate RNA fragments. This is particularly effective with 5'-end labeled substrates, allowing visualization of specific cleavage products .

  • HPLC or capillary electrophoresis: For high-resolution separation and quantification of cleavage products.

  • Mass spectrometry: For precise determination of cleavage product masses and confirmation of cleavage sites.

  • Specialized RNA sequencing approaches: Methods like cP-RNA-seq and P-cP-RNA-seq have been used to identify and characterize 2′,3′-cyclic phosphate-containing RNAs generated by RNase κ in biological contexts . These approaches can be adapted to in vitro studies of recombinant enzyme activity.

  • Fluorescence-based assays: Using fluorescently labeled RNA substrates with quenchers positioned to create signal upon cleavage, allowing real-time monitoring of activity.

For studying the specific 2′,3′-cyclic phosphate ends generated by Rnasek, specialized biochemical techniques that distinguish these termini from other RNA ends are particularly valuable .

How can recombinant Rnasek be used to study piRNA biogenesis pathways?

Recombinant mouse Rnasek can serve as a powerful tool for investigating piRNA biogenesis pathways through several approaches:

  • In vitro reconstitution experiments: Purified recombinant Rnasek can be used with defined RNA substrates to reconstitute the initial steps of piRNA processing, allowing detailed mechanistic studies of how precursor RNAs are cleaved and processed.

  • Substrate identification: By exposing cellular RNA pools to recombinant Rnasek and identifying the cleaved products through specialized RNA sequencing methods like cP-RNA-seq, researchers can determine the preferred in vivo substrates .

  • Structure-function analysis: Using site-directed mutagenesis of recombinant Rnasek to identify critical residues for catalytic activity and substrate recognition, providing insights into the enzyme's mechanism.

  • Protein-protein interaction studies: Purified recombinant Rnasek can be used in pull-down assays or other interaction studies to identify binding partners within the piRNA biogenesis machinery.

  • Complementation experiments: Recombinant Rnasek can be introduced into Rnasek-depleted cells to rescue piRNA production and associated phenotypes, confirming the specific role of the enzyme in this pathway .

What is the relationship between Rnasek activity and transposon silencing?

RNase κ plays a crucial role in transposon silencing through its function in the piRNA pathway. Research has demonstrated that:

  • Depletion of RNase κ in Bombyx resulted in elevated transposon levels, indicating that the enzyme is essential for transposon silencing .

  • The mechanism involves RNase κ's generation of 2′,3′-cyclic phosphate-containing piRNA precursors, which are subsequently processed into mature piRNAs .

  • These piRNAs associate with PIWI proteins to form complexes that target and silence complementary transposon sequences through both transcriptional and post-transcriptional mechanisms.

  • The specific cleavage preferences of RNase κ may influence which transposon-derived transcripts are processed into piRNAs, potentially creating a level of selectivity in transposon targeting.

Recombinant mouse Rnasek can be used to study these relationships by examining how alterations in enzyme activity (through mutations or inhibition) affect the generation of specific piRNAs and subsequent transposon silencing efficiency.

How can structural studies of Rnasek inform the development of targeted modulators?

Structural studies of mouse Rnasek would provide valuable insights for developing modulators of its activity:

  • Structure determination: X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy could be used to resolve the three-dimensional structure of Rnasek, potentially in complex with RNA substrates or inhibitors.

  • Active site mapping: Identifying the catalytic residues and understanding their spatial arrangement would inform the design of specific inhibitors that mimic the transition state of RNA cleavage.

  • Substrate binding pocket analysis: Defining how the enzyme recognizes and binds its preferred RNA substrates would allow for the design of competitive inhibitors or alternative substrates.

  • Allosteric site identification: Discovering potential allosteric regulatory sites could lead to the development of modulators that alter enzyme activity without directly competing with substrate binding.

  • Species-specific differences: Comparing structures across species could reveal unique features of mouse Rnasek that might be exploited for selective targeting.

The development of specific Rnasek modulators would provide valuable research tools for studying the enzyme's biological functions and potential therapeutic applications if Rnasek dysregulation is linked to disease states.

What are common issues in Rnasek activity assays and how can they be resolved?

Researchers commonly encounter several challenges when performing Rnasek activity assays:

  • RNase contamination: Environmental RNases can contaminate reagents and samples, leading to background activity.

    • Solution: Use RNase-free reagents, DEPC-treated water, wear gloves, and implement stringent laboratory practices to minimize contamination .

  • Substrate degradation issues: RNA substrates may degrade during storage or handling.

    • Solution: Store RNA substrates at -80°C in RNase-free conditions, minimize freeze-thaw cycles, and consider adding RNase inhibitors (though note that standard RNase inhibitors may not affect Rnasek as it is resistant to placental ribonuclease inhibitor) .

  • Variable enzymatic activity: Inconsistent activity between preparations.

    • Solution: Standardize purification protocols, implement quality control testing for each batch, and consider using internal standards to normalize between experiments.

  • Detection sensitivity limitations: Difficulty in detecting low levels of cleavage products.

    • Solution: Use highly sensitive detection methods such as radioactive or fluorescent labeling of substrates, or consider amplification-based detection methods.

  • Non-specific binding: Protein adhering to surfaces of reaction vessels.

    • Solution: Include carrier proteins or low concentrations of detergents in reaction buffers to prevent loss of enzyme through non-specific binding.

How can researchers distinguish between Rnasek activity and other cellular ribonucleases?

Distinguishing Rnasek activity from other ribonucleases is crucial for specific functional studies. Several approaches can help achieve this specificity:

  • Substrate specificity: Utilize RNA substrates that contain Rnasek's preferred cleavage sites (ApU and ApG phosphodiester bonds), which may not be preferentially cleaved by other ribonucleases .

  • Inhibitor resistance: Take advantage of Rnasek's resistance to the placental ribonuclease inhibitor, which inhibits many other ribonucleases but not Rnasek .

  • Product analysis: Characterize the cleavage products, as Rnasek generates 2′,3′-cyclic phosphate ends that can be distinguished from products of other ribonucleases .

  • Immunodepletion: Use specific antibodies against Rnasek to deplete it from samples, comparing activity before and after depletion.

  • Genetic approaches: Use samples from Rnasek knockout or knockdown models compared to wildtype controls to identify Rnasek-specific activities.

  • Recombinant enzyme validation: Compare activities using purified recombinant Rnasek as a positive control with defined characteristics.

What are the key considerations for storing and maintaining recombinant Rnasek stability?

To ensure optimal stability and activity of recombinant mouse Rnasek:

  • Storage conditions:

    • Store the purified enzyme at -80°C for long-term storage.

    • For working solutions, store at -20°C in small aliquots to avoid repeated freeze-thaw cycles.

    • Consider adding stabilizing agents such as glycerol (typically 10-50%) or BSA as a carrier protein.

  • Buffer composition:

    • Maintain pH stability with appropriate buffers (e.g., Tris-HCl or phosphate buffers).

    • Include reducing agents (e.g., DTT or β-mercaptoethanol) if the enzyme contains cysteine residues that might form disulfide bonds.

    • Consider adding divalent cations if they enhance stability.

  • Handling precautions:

    • Avoid repeated freeze-thaw cycles by preparing small single-use aliquots.

    • Keep on ice when working with the enzyme at the bench.

    • Use RNase-free tubes and tips to prevent contamination.

  • Quality control:

    • Periodically test enzyme activity using standardized assays.

    • Monitor protein integrity by SDS-PAGE or other analytical methods.

    • Consider including enzyme stabilizers such as glycerol or non-ionic detergents at low concentrations.

  • Shipping and transport:

    • Transport on dry ice for frozen enzyme.

    • For lyophilized preparations, ensure protection from moisture and maintain appropriate temperature.

What are the emerging applications of Rnasek in RNA biology research?

Several emerging applications of Rnasek in RNA biology research show promise:

  • piRNA pathway engineering: Using recombinant Rnasek to manipulate piRNA biogenesis for studying transposon control and germline development .

  • RNA end chemistry studies: Exploring the significance of 2′,3′-cyclic phosphate RNA ends in various cellular processes beyond piRNA pathways .

  • Development of novel RNA sequencing methodologies: Building on techniques like cP-RNA-seq and P-cP-RNA-seq to identify and characterize specific RNA populations in different biological contexts .

  • RNA decay pathway investigations: Utilizing Rnasek's specific cleavage properties to study specialized RNA degradation mechanisms.

  • Epitranscriptomic regulation: Investigating how Rnasek activity might interact with or be affected by RNA modifications that constitute the epitranscriptome.

  • Mitochondrial RNA metabolism: Exploring the significance of Rnasek's mitochondrial association and potential roles in mitochondrial RNA processing .

These applications would benefit from continued development of recombinant Rnasek as a research tool, as well as more sophisticated methods to track its activity in cellular contexts.

How might Rnasek be involved in disease processes or developmental regulation?

Given its fundamental biological functions, Rnasek may have significant roles in disease processes and development:

  • Cancer biology: Like other ribonucleases that show anti-tumor activities, Rnasek might have roles in tumor suppression or progression . Its involvement in regulatory RNA pathways suggests potential impacts on oncogenic or tumor-suppressor gene expression.

  • Developmental regulation: The disruption of piRNA-mediated sex determination observed in Bombyx upon Rnasek depletion suggests critical developmental functions . In mammals, Rnasek might similarly regulate key developmental processes through piRNA pathways or other RNA regulatory mechanisms.

  • Neurodegenerative diseases: RNA metabolism dysregulation is implicated in various neurodegenerative conditions. Rnasek's role in RNA processing pathways could connect to these disease mechanisms.

  • Fertility and gametogenesis: Given the importance of piRNAs in germline development and fertility, Rnasek dysfunction might contribute to fertility disorders.

  • Inflammatory and autoimmune conditions: Many RNases have been implicated in inflammatory and autoimmune processes , suggesting potential roles for Rnasek in these disease categories.

  • Viral defense: The RNA processing capabilities of Rnasek might play roles in cellular defense against RNA viruses or other pathogens.

What comparative studies between species could reveal about Rnasek evolution and function?

Comparative studies across species could provide valuable insights into Rnasek evolution and function:

  • Evolutionary conservation analysis: The extremely high conservation rate of Rnasek across species (>98% among mammals) suggests strong evolutionary pressure to maintain its function . Detailed phylogenetic analysis could reveal when this enzyme emerged in evolution and how it has been conserved.

  • Functional divergence investigation: Despite high sequence conservation, species-specific differences in Rnasek function might exist. Comparing the enzymatic properties and biological roles of Rnasek across diverse species could highlight any functional specialization.

  • Structural comparisons: Resolving and comparing the three-dimensional structures of Rnasek from different species could identify critical structural features that have been maintained throughout evolution.

  • Expression pattern analysis: Examining differences in tissue-specific expression patterns across species might reveal specialized roles that have evolved in certain lineages.

  • Interactome studies: Identifying and comparing Rnasek protein-protein interactions across species could uncover conserved and divergent functional networks.

  • Substrate preference evolution: Investigating whether substrate preferences have shifted during evolution could provide insights into the adaptation of Rnasek function to different biological contexts.

These comparative approaches would contribute significantly to our understanding of this highly conserved but still incompletely characterized enzyme family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.