Recombinant Mouse RING finger and transmembrane domain-containing protein 1 (Rnft1)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Domains

Rnft1 is a multi-pass transmembrane protein characterized by:

  • RING-HC finger domain: A C3HC4-type zinc-binding motif (residues 89–128) essential for E3 ubiquitin ligase activity .

  • Transmembrane domains: Four or more helical regions anchoring it to the ER membrane .

  • Ubiquitin-binding motifs: Critical for substrate recognition in the ERAD pathway .

Chemical Modulators of Rnft1 Expression

Compound/StressEffect on Rnft1SpeciesSource
2,3,7,8-TetrachlorodibenzodioxinDecreases mRNARat CTD
Valproic AcidIncreases mRNA, decreases methylationHuman CTD
ER Stressors (e.g., tunicamycin)2-fold inductionHuman Nature
Manganese ChlorideIncreases mRNAHuman CTD

In Vitro Characterization

  • Autoubiquitination: Wild-type Rnft1 exhibits robust E3 activity in vitro, while RING domain mutants (ΔR/CS) show reduced activity .

  • Subcellular Localization: Predominantly ER-localized, with partial Golgi presence .

ER Stress Pathways

  • Rnft1 is upregulated by the unfolded protein response (UPR) transcription factor XBP1 .

  • Unlike HRD1, Rnft1 does not require ATF6 for induction .

Disease Implications

While direct disease associations are not yet established, Rnft1’s role in ERAD suggests potential links to:

  • Neurodegenerative disorders (e.g., Alzheimer’s) via protein aggregation.

  • Cancer, through dysregulated stress adaptation .

Interaction Partners

Rnft1 collaborates with proteins involved in ubiquitination and stress response:

  • CGRRF1: Inhibits cell growth but lacks E3 activity .

  • RNF170: Mediates ITPR1 degradation in ERAD .

  • RNF145: Regulates cholesterol homeostasis and NADPH oxidase turnover .

Technical Applications

Recombinant Rnft1 is utilized in:

  • ERAD mechanistic studies: Overexpression models to probe substrate specificity.

  • Drug screening: Identifying ERAD modulators using Rnft1-dependent luciferase assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rnft1; E3 ubiquitin-protein ligase RNFT1; RING finger and transmembrane domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rnft1
Target Protein Sequence
MQASCNQLHDPPGTAHEDAAASPCGHSRSTEGSLHPGDVHIQINSGPKEYSENPSSRNPR SGVCTCAHGCVHGRFRSYSHSEARPPDDFATESGEHGSGSFSEFRYLFKWLQKSLPYILI LGIKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRERSSKLRCAWLLVFLAGSSVLLY YTFHSQSLHYSLIFLNPTLEQLSFWEVLWIVGITDFILKFFFMGLKCLILLVPSFIMPFK SKGYWYMLLEELCQYYRIFVPIPVWFRYLISYGEFGNVTTWSLGILLALLYLILKLLDFF GHLRTFRQVLRVFFTRPSYGVPASKRQCSDMDGICTICQAEFQKPVLLFCQHIFCEECIT LWFNREKTCPLCRTVISECINKWKDGATSSHLQMY
Uniprot No.

Target Background

Function

Recombinant Mouse RING finger and transmembrane domain-containing protein 1 (Rnft1) is an E3 ubiquitin-protein ligase functioning within the endoplasmic reticulum-associated degradation (ERAD) pathway. It targets misfolded proteins accumulating in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasomal degradation. Rnft1 plays a crucial role in protecting cells from ER stress-induced apoptosis.

Database Links
Subcellular Location
Early endosome membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in testis.

Q&A

What is mouse Rnft1 and what are its key structural characteristics?

Mouse Rnft1 (E3 ubiquitin-protein ligase RNFT1) is a transmembrane protein containing a RING finger domain that functions as an E3 ubiquitin ligase. The protein contains multiple structural domains, most notably the N-terminal RING finger domain which is critical for its E3 ligase activity, and transmembrane regions that anchor it to the endoplasmic reticulum (ER) membrane . The mouse Rnft1 protein is approximately 390 amino acids in length and contains several conserved functional motifs that enable its participation in protein quality control pathways. These structural features are essential for its ability to identify and target misfolded proteins for degradation via the ubiquitin-proteasome pathway.

What post-translational modifications occur on mouse Rnft1?

Mouse Rnft1 undergoes several important post-translational modifications that regulate its function and stability. According to proteomic analyses, Rnft1 can be modified at multiple sites including:

SitePTM TypeSource
T14PhosphorylationPhosphoSitePlus
S22PhosphorylationPhosphoSitePlus
S79PhosphorylationPhosphoSitePlus
K382UbiquitinationPhosphoSitePlus

These modifications likely play critical roles in regulating Rnft1's E3 ligase activity, protein-protein interactions, subcellular localization, and stability . Researchers investigating Rnft1 function should consider how these modifications might be dynamically regulated under different cellular conditions, particularly during ER stress when Rnft1 activity appears to be most significant.

How is Rnft1 expression regulated during ER stress conditions?

Rnft1 expression is significantly upregulated during endoplasmic reticulum (ER) stress, suggesting its importance in cellular stress responses. Genome-wide studies have identified Rnft1 as one of four genes (along with RNF185, CGRRF1, and RNF19B) whose expression is significantly increased under ER stress conditions . This upregulation appears to be part of the cellular protective mechanism against the accumulation of misfolded proteins in the ER.

The transcriptional regulation of Rnft1 likely involves unfolded protein response (UPR) signaling pathways, which are activated during ER stress. The increased expression of Rnft1 during such conditions enables cells to enhance their capacity for removing misfolded proteins through ER-associated degradation (ERAD), thereby preventing proteotoxicity and promoting cell survival.

What is the tissue distribution pattern of Rnft1 in mice?

While comprehensive tissue distribution data for mouse Rnft1 is limited in the provided search results, studies of related RING finger proteins suggest that their expression can be tissue-specific. For instance, Znf179, another RING finger protein, shows predominant expression in brain and testis . Understanding the tissue-specific expression pattern of Rnft1 would provide valuable insights into its physiological roles.

For researchers conducting expression studies, quantitative PCR, Western blotting of tissue lysates, and immunohistochemistry using validated anti-Rnft1 antibodies would be recommended approaches to determine the tissue distribution pattern. These methodologies should be optimized for mouse tissues to ensure specific detection of Rnft1.

What is the role of Rnft1 in ER-associated degradation (ERAD)?

Rnft1 functions as an E3 ubiquitin ligase in the ER-associated degradation (ERAD) pathway, a critical quality control mechanism that targets misfolded proteins in the ER for degradation by the ubiquitin-proteasome system. Rnft1 has been identified as a candidate ERAD E3 ligase through genomic searches for proteins containing both RING-finger motifs and transmembrane regions, which are key structural features of ERAD E3 ligases .

Mechanistically, Rnft1 displays RING-dependent E3 ubiquitin ligase activity, meaning its RING domain is essential for transferring ubiquitin molecules to substrate proteins. This ubiquitination marks misfolded proteins for recognition by the proteasome, leading to their degradation. Experimental evidence shows that Rnft1 confers significant resistance to ER stress-induced cell death in a manner dependent on its E3 ligase activity . This suggests that Rnft1 plays a protective role during ER stress by helping to clear potentially toxic misfolded proteins.

How does Rnft1 contribute to cellular resistance against ER stressors?

Rnft1 has been demonstrated to provide significant protection against ER stress-induced cell death in a manner that depends on its E3 ubiquitin ligase activity. Studies have shown that Rnft1 suppresses ER stress-induced cell death in a stress-specific manner, similar to another known ERAD E3 ligase, HRD1 .

The protective mechanism likely involves:

  • Enhanced clearance of misfolded proteins that accumulate during ER stress

  • Reduction of ER stress burden by preventing the aggregation of damaged proteins

  • Facilitation of protein homeostasis (proteostasis) during stress conditions

  • Possible regulation of ER stress signaling pathways

For researchers investigating ER stress responses, overexpression and knockdown studies of Rnft1 in cellular models subjected to various ER stressors (e.g., tunicamycin, thapsigargin) would provide valuable insights into its protective mechanisms and substrate specificity.

What are the optimal conditions for recombinant expression of mouse Rnft1?

Recombinant expression of mouse Rnft1 requires careful consideration of its structural features, particularly its transmembrane domains which can complicate heterologous expression. When designing expression systems for mouse Rnft1, researchers should consider:

  • Expression vector selection: Vectors containing strong promoters for mammalian expression (e.g., pcDNA3.1) are suitable for full-length Rnft1 expression .

  • Host cell selection: Mammalian cell lines (e.g., HEK293, CHO) are preferable for maintaining proper folding and post-translational modifications.

  • Transmembrane domain handling: For biochemical studies requiring soluble protein, consider expressing only the cytosolic domains (particularly the RING domain) while excluding the transmembrane regions.

  • Purification strategy: Addition of affinity tags (His, FLAG, or GST) can facilitate purification, but tag placement should avoid disrupting the RING domain or transmembrane regions.

  • Expression verification: Western blotting and activity assays to confirm proper expression and functional E3 ligase activity.

How can I effectively design siRNA experiments targeting mouse Rnft1?

When designing siRNA experiments to knockdown Rnft1 expression in mouse cells or tissues, researchers should follow these methodological guidelines:

  • siRNA design: Multiple siRNAs targeting different regions of the Rnft1 mRNA should be designed to ensure specificity and efficacy. While the search results show human RNFT1 siRNA sets , similar approaches can be applied for mouse Rnft1.

  • Controls: Include negative controls (non-targeting siRNA), positive controls (targeting a housekeeping gene like GAPDH), and if possible, fluorescently labeled siRNAs to monitor transfection efficiency.

  • Validation: Confirm knockdown efficiency at both mRNA level (qRT-PCR) and protein level (Western blotting) at various time points post-transfection.

  • Functional assessment: Evaluate the consequences of Rnft1 knockdown on ER stress responses, ubiquitination patterns, and cell viability under normal and stressed conditions.

  • Rescue experiments: To confirm specificity, perform rescue experiments with siRNA-resistant Rnft1 variants.

For mouse cell culture experiments, transfection conditions (reagent, cell density, siRNA concentration) should be optimized for each cell type to maximize knockdown efficiency while minimizing off-target effects.

How conserved is Rnft1 across different species?

Rnft1 shows significant evolutionary conservation across various species, indicating its fundamental importance in cellular function. The search results reveal that Rnft1 has been identified and characterized in several organisms:

  • Mouse (Mus musculus): Characterized as E3 ubiquitin-protein ligase RNFT1 (Q9DCN7)

  • Human: Shares high homology with mouse Rnft1 and also functions as an E3 ubiquitin ligase

  • Anna's hummingbird (Calypte anna): Identified as both "RING finger and transmembrane domain-containing protein 1" and "E3 ubiquitin-protein ligase RNFT1"

The functional conservation of Rnft1 across such diverse species suggests it plays a fundamental role in cellular proteostasis. The E3 ubiquitin ligase activity and involvement in ER stress responses appear to be conserved functions, though species-specific adaptations may exist.

For researchers interested in evolutionary aspects of Rnft1, comparative studies examining the conservation of key functional domains (particularly the RING finger domain) and analysis of species-specific differences in expression patterns and regulation would be valuable approaches.

What are the current challenges in studying Rnft1 substrate specificity?

Identifying the specific substrates of E3 ubiquitin ligases like Rnft1 remains one of the most challenging aspects of their functional characterization. The challenges include:

  • Transient interactions: The interaction between E3 ligases and their substrates is often transient and of low affinity, making traditional interaction studies difficult.

  • Condition-specific regulation: Substrate recognition may be regulated by specific cellular conditions (e.g., ER stress) or post-translational modifications.

  • Redundancy: Multiple E3 ligases may target the same substrates, complicating the analysis of specific ligase-substrate relationships.

  • Technical limitations: Detecting ubiquitination events in physiological contexts requires sensitive and specific methodologies.

To overcome these challenges, researchers might employ:

  • Proximity labeling approaches (BioID, APEX) to identify proteins in close proximity to Rnft1

  • Quantitative proteomics comparing ubiquitination patterns in wild-type versus Rnft1-deficient systems

  • In vitro ubiquitination assays with candidate substrates

  • Structure-function studies to identify substrate recognition motifs in Rnft1

Is Rnft1 dysregulation associated with specific disease models?

While the direct association of Rnft1 with specific diseases isn't explicitly detailed in the provided search results, its function as an E3 ubiquitin ligase involved in ER stress responses suggests potential implications in diseases associated with protein misfolding and ER dysfunction. These might include:

  • Neurodegenerative disorders: Conditions like Alzheimer's, Parkinson's, and ALS involve protein misfolding and aggregation.

  • Metabolic disorders: ER stress is a key feature in diabetes and obesity.

  • Inflammatory conditions: ER stress can trigger inflammatory signaling pathways.

For researchers interested in exploring the pathological significance of Rnft1, studies using tissue samples from disease models and patients, combined with functional analyses in disease-relevant cell types, would be valuable approaches.

What phenotypes are observed in Rnft1 knockout or knockdown models?

  • Enhanced susceptibility to ER stress: Since Rnft1 provides protection against ER stress-induced cell death , its absence might render cells more vulnerable to ER stressors.

  • Accumulation of specific misfolded proteins: If Rnft1 targets specific substrates for degradation, these might accumulate in its absence.

  • Tissue-specific effects: The phenotype might vary across tissues depending on the relative importance of Rnft1 in different cell types.

For researchers planning to generate or study Rnft1 knockout models, comprehensive phenotyping approaches should include:

  • Analysis of ER morphology and function under basal and stressed conditions

  • Examination of tissue-specific pathologies, with particular attention to the brain and other tissues where ERAD function is critical

  • Evaluation of susceptibility to conditions that induce ER stress (e.g., aging, metabolic challenges)

  • Proteomic analysis to identify accumulated substrates

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.