Recombinant Mouse RING finger and transmembrane domain-containing protein 2 (Rnft2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
Rnft2; Tmem118; RING finger and transmembrane domain-containing protein 2; Transmembrane protein 118
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rnft2
Target Protein Sequence
MWLLAAHQVLRKMQRRHSSNTDNIPPERSRSQALSPEASVDEGGVFESLKAETASPPALF SGLAGGLPASPFPAGLVLGSTAGGGDVFIPMPATRDEAGGRSAEGSTYHHRQAHHHFHHG AHRGGSLLQHVGGDHRGHSEEGVDEQPGTPAPALSELKAVISWLQKGLPFILILLAKLCF QHKLGIAVCIGMASTFAYANSTLREQVSLKEKRSVLVILWILAFLAGNTMYVLYTFSSQQ LYSSLIFLKPNLETLDFFDLLWIVGIADFVLKYITIALKCLIVALPKIILAVKSKGKFYL VIEELSQLFRSLVPIQLWYKYIMGDDSSNSYFLGGVLIVLYSLCKSFDICGRVGGLRKAL KLLCTSQNYGVRATGQQCTEAGAVCAICQAEFRDPMILLCQHVFCEECLCLWLDRERTCP LCRSVAVDTLRCWKDGATSAHLQVY
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is RNFT2 and what is its basic structure?

RNFT2 (Ring Finger and Transmembrane Domain-Containing Protein 2) is a protein-coding gene that produces a transmembrane protein containing a RING finger domain. In mice, the full-length RNFT2 protein consists of 445 amino acids . The protein contains both transmembrane domains and a RING finger motif, which typically functions in mediating protein-protein interactions and is commonly associated with E3 ubiquitin ligase activity . The protein structure includes several transmembrane segments that anchor it to cellular membranes, while the RING finger domain extends into the cytoplasm to facilitate its molecular functions.

What are the primary molecular functions of RNFT2?

RNFT2 has been implicated in mediating protein interactions and participating in the ubiquitination of target proteins . As a protein containing a RING finger domain, it likely functions as part of the ubiquitin-proteasome pathway, potentially tagging specific proteins for degradation. Research indicates that RNFT2 may play a role in epithelial-mesenchymal transition (EMT), as its expression in gastric cancer cell lines positively correlates with EMT-related molecules including GSC, MMP9, and RAC1 . This suggests RNFT2 may be involved in cellular processes related to cell adhesion, migration, and invasion, particularly in the context of cancer progression.

What are the optimal conditions for storing and handling recombinant RNFT2 protein?

Recombinant RNFT2 protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For optimal stability, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being standard in many commercial preparations) . After reconstitution, the protein should be stored at -20°C/-80°C for long-term storage, with working aliquots kept at 4°C for up to one week to avoid degradation . Repeated freeze-thaw cycles should be avoided as they can compromise protein integrity and activity . Before opening the vial, it is advisable to briefly centrifuge to bring the contents to the bottom, especially with lyophilized preparations.

What experimental approaches are most effective for studying RNFT2 expression in tissue samples?

Based on the research methodologies described in the literature, quantitative PCR (qPCR) has been effectively employed to measure RNFT2 mRNA expression levels in both normal and cancerous tissues . For this approach, researchers should:

  • Collect tissue samples and immediately freeze them in liquid nitrogen before storing at -80°C to preserve RNA integrity

  • Extract RNA from tumor samples without necrotic areas (as determined by gross observation)

  • Design specific primers for RNFT2 that enable reliable quantification

  • Use appropriate housekeeping genes (such as GAPDH) for normalization

  • Analyze relative expression using statistical methods such as the Mann-Whitney U-test to compare expression between cancer and adjacent normal tissues

For more comprehensive analysis, transcriptome sequencing (RNA-Seq) on platforms such as Illumina HiSeq can be used to evaluate RNFT2 expression in the context of global gene expression profiles .

What molecular mechanisms link RNFT2 to cancer metastasis and EMT?

Research has demonstrated a positive correlation between RNFT2 expression in gastric cancer cell lines and several EMT-related molecules, including GSC, MMP9, and RAC1 . These molecular associations suggest that RNFT2 may contribute to cancer progression through the following mechanisms:

  • Promotion of EMT, which is a critical process for cancer cells to acquire migratory and invasive properties

  • Enhancement of matrix degradation through association with MMP9, facilitating tumor invasion

  • Modulation of cytoskeletal dynamics via RAC1, potentially affecting cell motility

The specific molecular pathways through which RNFT2 regulates these processes remain to be fully elucidated, presenting an important area for future research. Understanding these mechanisms could potentially reveal therapeutic targets for preventing metastasis in gastric cancer patients with high RNFT2 expression.

What cell models are most appropriate for studying RNFT2 function?

Based on the research literature, multiple gastric cancer cell lines have been used to study RNFT2 expression and function. Among the 14 gastric cancer cell lines tested, 10 showed higher RNFT2 expression compared to control epithelial cells, with N87, MKN1, and IM95 being specifically mentioned . When selecting cell models for RNFT2 research, researchers should consider:

  • The baseline expression level of RNFT2 in different cell lines

  • The expression of EMT-related genes that correlate with RNFT2 (GSC, MMP9, RAC1)

  • The metastatic potential of the cell lines, particularly for studying RNFT2's role in cancer progression

  • The feasibility of genetic manipulation (knockout, knockdown, or overexpression) in the selected cell lines

For comparative studies, including both high and low RNFT2-expressing cell lines would provide valuable insights into RNFT2-dependent cellular mechanisms.

How can researchers effectively analyze the relationship between RNFT2 and EMT-related molecules?

To investigate the relationship between RNFT2 and EMT-related molecules, researchers have employed RT2 Profiler PCR Arrays to evaluate the expression of EMT-related genes and correlate them with RNFT2 expression . For robust analysis, researchers should:

  • Measure RNFT2 expression across multiple cell lines or patient samples

  • Profile the expression of known EMT markers and regulators (such as GSC, MMP9, and RAC1)

  • Perform correlation analyses using appropriate statistical methods (such as Spearman's rank correlation coefficient)

  • Validate findings through protein-level analyses (Western blot, immunohistochemistry)

  • Conduct functional studies through RNFT2 knockdown or overexpression to assess causative relationships

This comprehensive approach allows for the identification of potential mechanistic links between RNFT2 and EMT processes in cancer progression.

What statistical approaches should be used to analyze RNFT2 expression data in clinical samples?

Based on published research methodologies, the following statistical approaches are recommended for analyzing RNFT2 expression data in clinical samples:

  • For comparing RNFT2 expression between cancer and normal tissues: Mann-Whitney U-test for non-parametric analysis of relative mRNA expression levels (RNFT2/GAPDH)

  • For analyzing associations between RNFT2 expression and clinicopathological parameters: Chi-square test

  • For correlation analyses between RNFT2 and other genes: Spearman's rank correlation coefficient

  • For survival analyses: Kaplan-Meier method with log-rank test to compare survival curves between high and low RNFT2 expression groups

  • For multivariate analysis of prognostic factors: Cox proportional hazards model with variables having p<0.05 in univariate analysis

Statistical software such as JMP (SAS Institute Inc.) has been successfully used for these analyses, with p<0.05 considered statistically significant .

How should cutoff values for high versus low RNFT2 expression be determined?

Determining appropriate cutoff values for classifying samples as having high or low RNFT2 expression is critical for meaningful clinical correlations. Based on research methodologies:

  • The median value of RNFT2 expression across the study population can be used as a threshold to categorize patients into high and low expression groups

  • Receiver operating characteristic (ROC) curve analysis can be performed to determine the optimal cutoff value that maximizes sensitivity and specificity for predicting specific clinical outcomes (e.g., recurrence or survival)

  • Alternative approaches include using quartiles or percentiles (e.g., upper tertile vs. lower two tertiles) based on the distribution of expression values in the study population

  • The selected cutoff value should be validated in independent cohorts when possible

The choice of method should be clearly justified and reported to ensure reproducibility of findings across different research studies.

What are the promising approaches for targeting RNFT2 in cancer therapy?

Given the association between high RNFT2 expression and poor prognosis in gastric cancer, several therapeutic approaches warrant investigation:

  • Development of small molecule inhibitors targeting RNFT2's RING finger domain to disrupt its potential ubiquitin ligase activity

  • Exploration of antisense oligonucleotides or siRNA-based approaches to downregulate RNFT2 expression

  • Investigation of compounds that might disrupt interactions between RNFT2 and its binding partners, particularly those involved in EMT

  • Combination approaches targeting both RNFT2 and associated EMT pathways to prevent metastasis

  • Biomarker-guided treatment strategies using RNFT2 expression to identify patients who might benefit from more aggressive adjuvant therapy

The development of these approaches would require detailed structural and functional characterization of RNFT2, including identification of its substrates and interacting proteins.

What is the potential role of RNFT2 in other cancer types beyond gastric cancer?

While current research has primarily focused on RNFT2's role in gastric cancer, its involvement in EMT processes suggests potential relevance in other cancer types, particularly those where invasion and metastasis are significant clinical challenges. Future research directions could include:

  • Comprehensive analysis of RNFT2 expression across different cancer types using publicly available databases

  • Investigation of correlations between RNFT2 expression and clinical outcomes in other epithelial cancers

  • Functional studies examining RNFT2's role in the progression of various tumor types

  • Exploration of tissue-specific mechanisms through which RNFT2 might contribute to cancer development and progression

  • Comparative analysis of RNFT2's molecular interactions across different cellular contexts

These investigations would help determine whether RNFT2 represents a broadly applicable biomarker and potential therapeutic target across multiple cancer types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.