Recombinant Mouse RING finger protein 148 (Rnf148)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse RING finger protein 148 (Rnf148) is a protein that, in humans, is encoded by the RNF148 gene . Rnf148 is an E3 ubiquitin ligase and may function as an oncogene in colorectal cancer .

General Information

CategoryDescription
Gene NameRing Finger Protein 148
SourceMouse
Product CodeCSB-CF019844MO
Expression SystemIn vitro E. coli expression system
PurityHigh purity
UniGeneMm.443309
KEGGmmu:71300
STRING10090.ENSMUSP00000100592
Protein LengthFull Length of Mature Protein
ApplicationThis product has not been tested for all applications. It is up to the end user to determine suitability for their application .

Function and Role

Rnf148 functions as an E3 ubiquitin ligase . E3 ubiquitin ligases are enzymes that facilitate the transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate protein, marking it for degradation or altering its function . In colorectal cancer, RNF148 promotes cancer progression through ubiquitination-mediated degradation of CHAC2 .

Expression Analysis

The expression of RNF148 has been observed in various human tissues. One study compiled microarray expression profiles from the NCBI GEO database to analyze gene expression patterns across different tissues . The study integrated data from 2,968 microarray expression profiles of various human tissues and found that PARK2, another gene, is highly expressed in the testis .

Involvement in diseases

RNF148's role as an oncogene in colorectal cancer has been investigated, with studies showing its involvement in the progression of the disease . RNF148 is also part of an 8-gene signature related to dexamethasone/thalidomide .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rnf148; Greul3; RING finger protein 148; Goliath-related E3 ubiquitin-protein ligase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
13-316
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Rnf148
Target Protein Sequence
EMNPLGPTPSVHRSVSFWLLRLSVFLLLSLRDSKGKAIWTAHLNITFQVGNRIISELGES GVFGNHSPLERVSGAVVLPEGWNQNACSPLTNFSRPDQTDTWLALIERGGCTFTHKINLA AEKGANGVIIYNYPGTGNKVFPMSHQGTENIVAVMIGNLKGMELLHLIQQGVYVTIIIEV GRMHMPWLSHYVMSLFTFLAATVTYLFLYCAWRPRVSNSSTRRQRQLKADVKKAIGQLQL RVLQDGDKELDPNEDSCVVCFDMYKAQDVIRILTCKHFFHKTCIDPWLLAHRTCPMCKCD ILKP
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Overview

This comprehensive FAQ document addresses key research questions about RNF148, a testis-specific E3 ubiquitin ligase with emerging roles in reproductive biology and cancer pathways. The questions range from basic characterization to advanced functional analyses, providing methodological insights for researchers investigating this protein.

What is RNF148 and what is its primary function in biological systems?

RNF148 is a testis-specific E3 ubiquitin ligase that plays a critical role in protein homeostasis through the ubiquitin-proteasome pathway. It functions as a single-pass membrane protein containing a protease-associated (PA) domain and a RING-type zinc finger domain . The protein's primary function is to facilitate the attachment of ubiquitin molecules to substrate proteins, marking them for degradation via the proteasome system.

In vitro ubiquitination assays using GST-RNF148 fusion proteins have confirmed that the recombinant protein possesses E3 ubiquitin ligase activity, particularly through its RING finger domain . This mechanism is essential for maintaining proper protein quality control, especially in the testicular environment.

What is the tissue expression profile of RNF148 in mice and humans?

Mouse Expression:
RNF148 exhibits highly specific expression patterns:

  • Expression is almost exclusively restricted to the testis in adult mice

  • Northern blotting confirmed a single 1.2 kb mRNA band present in mouse testis

  • Temporal expression begins in the testis of day 21 mice, increases dramatically to peak levels by day 25, and continues to express thereafter

Human Expression:

  • Similar to mice, human RNF148 is predominantly expressed in testes

  • RT-PCR analysis of 16 human tissues showed abundant expression in testes with only slight expression in other tissues

  • In situ hybridization studies have confirmed the testicular localization of RNF148 mRNA

This testis-specific expression pattern strongly suggests a specialized role in spermatogenesis or sperm function.

What structural domains characterize the RNF148 protein?

RNF148 contains several key structural domains that define its function:

  • RING finger domain: Critical for E3 ubiquitin ligase activity; allows interaction with E2 conjugating enzymes

  • Protease-associated (PA) domain: Important for substrate recognition and binding; specifically shown to bind to the CHAC domain of CHAC2

  • Transmembrane region: A single transmembrane domain that anchors the protein to cellular membranes, particularly the endoplasmic reticulum

Domain structure analysis between RNF148 and its paralog RNF133 reveals significant similarity, with both proteins containing one transmembrane region followed by a cytoplasmic RING finger domain . This structural organization is consistent with its role as an ER-associated E3 ubiquitin ligase.

What experimental methods are most effective for studying RNF148's E3 ubiquitin ligase activity?

Several methodological approaches have proven effective for investigating RNF148's enzymatic activity:

In Vitro Ubiquitination Assay:

  • Construction of expression vectors for GST-RNF148 fusion proteins encompassing the entire RING domain

  • Expression in E. coli BL21(DE3) cells followed by purification with glutathione-sepharose 4B

  • In vitro reaction setup containing purified E1, E2, ubiquitin, ATP, and the GST-RNF148 fusion protein

  • Detection of polyubiquitin chains by western blot analysis

Co-Immunoprecipitation (Co-IP) Assays:

  • For studying RNF148 interactions with substrates such as CHAC2

  • Construction of deletion mutation vectors based on functional domains (PA domain, HRD1 domain, RING domain)

  • Co-transfection with tagged substrate proteins (e.g., pCMV6-CHAC2-DDK)

  • Western blot analysis to confirm domain-specific interactions

Domain Mapping:

  • Creating vectors with specific domain deletions: pCMV6-RNF148-PA-HA (ΔPA), pCMV6-RNF148-HRD1-HA (ΔHRD1), pCMV6-RNF148-RING-HA (ΔRING)

  • Functional testing of each construct to determine essential domains for activity

What is known about RNF148 knockout phenotypes compared to its paralog RNF133?

Despite their structural similarities, RNF148 and RNF133 exhibit distinct phenotypic effects when knocked out:

RNF148 Knockout:

  • RNF148 knockout mice show normal fertility comparable to control males

  • No significant differences in testis weight and most sperm parameters compared to controls

  • Only minor effects on sperm velocity parameters (VSL) at 120 minutes post-activation

RNF133 Knockout:

  • RNF133 knockout males exhibit significant subfertility (2.7 ± 0.18 pups per litter compared to control)

  • Sperm from RNF133 KO mice show compromised motility and impaired hyperactivation

  • These defects explain the reduced in vitro and in vivo fertilization capacity

RNF133/RNF148 Double Knockout:

  • Double knockout males maintain similar subfertility levels as RNF133 single knockouts (2.5 ± 0.15 pups)

  • This suggests limited functional redundancy between these paralogous proteins

These findings indicate that despite their chromosomal linkage and structural similarities (58.9% identity in mouse), RNF133 plays a more critical role in male fertility than RNF148 .

How does RNF148 expression and function differ between normal tissues and pathological states?

RNF148 shows significant differences between normal and pathological states, particularly in cancer:

Normal State:

  • Predominantly expressed in testicular tissue

  • Functions in protein quality control during spermatogenesis

  • Limited expression in other normal tissues

Pathological State (Colorectal Cancer):

Experimental evidence from in vivo studies:

  • RNF148-transfected cells (SW48-RNF148) exhibited accelerated tumor growth in nude mice compared to control cells

  • Immunohistochemistry showed higher Ki67 and N-cadherin expression and lower E-cadherin, active caspase-3, and cleaved PARP in RNF148-overexpressing tumors

  • RNF148 overexpression reduced lymphocytic infiltration in tumor tissues

These findings support RNF148 as an independent prognostic biomarker for colorectal cancer and a potential therapeutic target .

What is the molecular mechanism by which RNF148 targets CHAC2 for ubiquitination-mediated degradation?

The interaction between RNF148 and CHAC2 involves specific domains and molecular mechanisms:

Domain-Specific Interactions:

  • The protease-associated (PA) domain of RNF148 is necessary for binding to CHAC2

  • On CHAC2, the N-terminal region containing the ChaC domain is required for interaction with RNF148

  • Co-immunoprecipitation experiments with deletion mutants (RNF148-ΔPA, RNF148-ΔHRD1, RNF148-ΔRING) confirmed the PA domain's critical role

Phosphorylation and Ubiquitination Sites:

  • Two phosphorylation sites were identified on CHAC2, with Y118 being the critical residue

  • Three ubiquitination sites were identified, with K102 being the key ubiquitination residue

  • The phosphorylation status of Y118 may regulate the accessibility of K102 for ubiquitination

Functional Consequence:

  • This ubiquitination targets CHAC2 for proteasomal degradation

  • By degrading CHAC2, RNF148 prevents CHAC2-induced mitochondrial apoptosis through the endoplasmic reticulum stress pathway

  • This mechanism explains how RNF148 overexpression reduces apoptosis in cancer cells

This detailed understanding of the RNF148-CHAC2 interaction provides insights into both normal protein quality control and pathological processes in cancer.

How does RNF148 contribute to the endoplasmic reticulum (ER) quality control system?

RNF148 appears to be an integral component of the ER quality control system, particularly in testicular tissue:

Structural Evidence:

  • RNF148 contains a transmembrane domain that localizes it to the ER membrane

  • Its domain organization is typical of ER-resident E3 ubiquitin ligases involved in ER-associated degradation (ERAD)

Functional Integration:

  • RNF148 interacts with UBE2J1, an E2 ubiquitin-conjugating enzyme essential for spermiogenesis

  • UBE2J1 is known to be critical for the dislocation step of ER quality control

  • The RNF148-UBE2J1 interaction suggests cooperative function in ERAD pathways

Testis-Specific Role:

  • Expression coincides with the period when round spermatids transition to elongating spermatids (day 25)

  • This timing corresponds with intensive protein remodeling during spermatid differentiation

  • The testis-specific expression suggests adaptation of the ERAD system to the unique protein quality control needs during spermatogenesis

While RNF148 knockout alone does not significantly impair fertility, its potential redundancy with other E3 ligases or its specialized role in specific aspects of sperm formation warrants further investigation .

What experimental approaches are most effective for investigating RNF148's potential as a therapeutic target in colorectal cancer?

Based on RNF148's oncogenic properties in colorectal cancer, several experimental approaches could be employed for therapeutic target validation:

In Vitro Approaches:

  • RNAi-Mediated Knockdown:

    • siRNA targeting of RNF148 in colorectal cancer cell lines showed:

      • Reduced monoclonal formation ability

      • Inhibited cell growth and migration

      • Increased apoptosis rates and 5-FU sensitivity

    • These effects validate RNF148 as a potential therapeutic target

  • Domain-Specific Inhibition:

    • Targeting the PA domain that mediates CHAC2 binding

    • Developing small molecule inhibitors that prevent RNF148-CHAC2 interaction

    • Focus on disrupting the binding to the ChaC domain of CHAC2

  • Protein-Protein Interaction Network Analysis:

    • Identification of RNF148's interacting partners beyond CHAC2

    • Mapping the complete interaction network to identify additional intervention points

In Vivo Approaches:

These approaches would provide complementary insights into RNF148's potential as both a prognostic biomarker and therapeutic target in colorectal cancer.

How does the evolutionary conservation of RNF148 inform our understanding of its functional significance?

Evolutionary analysis of RNF148 provides important insights into its functional significance:

Sequence Conservation:

  • RNF148 and its paralog RNF133 share 58.9% and 54.9% identity in mouse and human, respectively

  • This moderate level of conservation suggests divergent functions despite similar domain structures

  • The RING finger domain shows higher conservation, highlighting the importance of the E3 ligase activity

Genomic Organization:

  • RNF148 and RNF133 genes are closely linked on mouse chromosome 6 by 11.01 centimorgan

  • This genomic arrangement is likely the result of gene duplication followed by functional divergence

  • Despite proximity, their distinct knockout phenotypes suggest evolutionary specialization

Cross-Species Analysis:

  • RNF148 has been identified in diverse mammals, including Elephantulus edwardii (Cape elephant shrew)

  • Neanderthal genome analysis has identified genomic regions containing genes involved in metabolism and cognitive and skeletal development, though specific information about RNF148 in hominins isn't provided in the search results

Functional Implications:

  • The testis-specific expression pattern is conserved between mice and humans, suggesting important reproductive functions

  • The divergence between RNF148 and RNF133 function (despite structural similarity) suggests evolutionary adaptation to different aspects of spermatogenesis

  • The apparent redundancy of RNF148 (based on normal fertility in knockout mice) raises questions about its evolutionary retention

This evolutionary perspective suggests that while RNF148 may be dispensable for basic fertility, it likely serves specialized functions in protein quality control during spermatogenesis that provided selective advantage during evolution.

What are the technical challenges in producing and utilizing recombinant RNF148 protein for functional studies?

Researchers working with recombinant RNF148 face several technical challenges:

Production Challenges:

  • As a membrane protein with a transmembrane domain, RNF148 can be difficult to express in soluble form

  • Expression systems must be carefully selected:

    • E. coli BL21(DE3) has been successfully used for GST-RNF148 fusion proteins encompassing the RING domain

    • Yeast expression systems have been employed for partial recombinant mouse RNF148

  • Purification typically requires affinity tags such as GST, with purification via glutathione-sepharose 4B

Stability Considerations:

  • Recombinant RNF148 stability is affected by multiple factors:

    • Buffer composition and pH

    • Storage temperature (recommended -20°C/-80°C)

    • Glycerol concentration (typically 5-50%, with 50% as default)

  • Repeated freezing and thawing should be avoided; working aliquots should be stored at 4°C for up to one week

Functional Assay Design:

  • In vitro ubiquitination assays require:

    • Purified E1 and appropriate E2 enzymes (UBE2J1 is a known partner)

    • ATP regeneration system

    • Appropriate substrate proteins (CHAC2 is a validated substrate)

  • Domain mapping experiments require careful design of truncation constructs to maintain proper folding

Quality Control:

  • Purity assessment by SDS-PAGE (>85% purity is typically achievable)

  • Functional validation through ubiquitination assays

  • Proper reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

These technical considerations are essential for researchers planning to work with recombinant RNF148 in their experimental designs.

How can researchers differentiate between the functions of RNF148 and other related E3 ubiquitin ligases in experimental settings?

Differentiating the specific functions of RNF148 from other E3 ligases requires strategic experimental approaches:

Genetic Approaches:

  • Single and Combinatorial Knockouts:

    • Compare phenotypes of single knockouts (RNF148 KO, RNF133 KO) versus double knockouts (RNF133/RNF148 DKO)

    • Assess functional redundancy through rescue experiments

    • The subfertility in RNF133 KO mice that remains unchanged in DKO mice suggests limited redundancy between these paralogs

  • Domain Swapping:

    • Create chimeric proteins exchanging domains between RNF148 and related E3 ligases

    • Particularly informative would be swapping the PA domain of RNF148 with corresponding domains from other E3 ligases

    • This approach can identify domain-specific functions

Biochemical Approaches:

  • Substrate Specificity:

    • Identify unique substrates through techniques like:

      • IP-MS (immunoprecipitation followed by mass spectrometry)

      • Ubiquitination site profiling

      • Degradome analysis before and after RNF148 manipulation

    • CHAC2 has been validated as a specific RNF148 substrate through its PA domain interaction

  • E2 Partner Profiling:

    • RNF148 interacts with UBE2J1, an E2 ubiquitin-conjugating enzyme

    • Comparative analysis of E2 partner preferences among different E3 ligases

    • In vitro ubiquitination assays with different E2 enzymes can reveal preferential partnerships

Expression Pattern Analysis:

  • Temporal-Spatial Expression:

    • RNF148 expression begins in day 21 mouse testes and peaks at day 25

    • Comparison with expression patterns of other E3 ligases can reveal non-overlapping temporal windows

    • In situ hybridization can identify cell type-specific expression patterns

  • Pathological Contexts:

    • Different E3 ligases may show distinct dysregulation patterns in disease states

    • RNF148 is upregulated in colorectal cancer, which may not be true for all related E3 ligases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.