Recombinant Mouse RING finger protein 170 (Rnf170)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse RING Finger Protein 170 (Rnf170)

Recombinant Mouse RING finger protein 170, abbreviated as Rnf170, is a protein encoded by the Rnf170 gene in Mus musculus (mouse). This protein is classified as an E3 ubiquitin ligase, which plays a crucial role in the ubiquitination process, a post-translational modification that regulates protein degradation and various cellular processes. Rnf170 is particularly involved in the ubiquitination of the inositol 1,4,5-trisphosphate receptor type 1 (ITPR1), impacting calcium signaling pathways within cells.

Functional Significance

Rnf170 has been implicated in several neurological disorders due to its role in regulating neuronal signaling pathways. Mutations in the Rnf170 gene have been associated with hereditary spastic paraplegia (HSP) and autosomal dominant sensory ataxia. Research has shown that loss of function mutations lead to significant neurodevelopmental defects and impaired neuronal function.

Research Findings

Recent studies have highlighted the importance of Rnf170 in cellular signaling and neurodevelopment:

  • Ubiquitination Role: Rnf170 is essential for the ubiquitination of ITPR1, which affects calcium release from the endoplasmic reticulum, crucial for various cellular functions .

  • Neurodevelopmental Impact: In zebrafish models, knockdown of rnf170 resulted in significant neurodevelopmental defects, emphasizing its role in neuronal maturation .

  • Clinical Associations: Variants in Rnf170 have been identified in patients with different phenotypes, including those with autosomal dominant sensory ataxia and hereditary spastic paraplegia .

References

  1. Bi-allelic variants in RNF170 cause hereditary spastic paraplegia.

  2. Recombinant Mouse RING finger protein 170 product details.

  3. ERLIN complex interactions with RNF170.

  4. RNF170 mutation causes autosomal dominant sensory ataxia.

  5. Clinical evaluations of RNF170 variants.

  6. Ubiquitin-protein ligase RNF170 functions.

  7. Canine RNF170 single base deletion study.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its inclusion in production.
Synonyms
Rnf170; E3 ubiquitin-protein ligase RNF170; RING finger protein 170; RING-type E3 ubiquitin transferase RNF170
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-286
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rnf170
Target Protein Sequence
MQRYWRFQDNKIQDICFGVLGESWIQRPVMARYYSEGQSLQQDDSFIEGVSDQVLVAVVV SLALTATLLYALLRNVQQNIHPENQELVRVLREQFQTEQDVPAPARQQFYTEMYCPICLH QASFPVETNCGHLFCGSCIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVIRL RQDVNDYNRRFSGQPRSIMERIMDLPTLLRHAFREVFSVGGLFWMFRIRIMLCLMGAFFY LISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR
Uniprot No.

Target Background

Function

Recombinant Mouse RING finger protein 170 (Rnf170) is an E3 ubiquitin-protein ligase crucial for stimulus-induced ubiquitination and degradation of inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) via the endoplasmic reticulum-associated degradation (ERAD) pathway. It also plays a role in ITPR1 turnover under resting conditions.

Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Rnf170 in mice?

Rnf170 is an E3 ubiquitin ligase that plays a critical role in the ubiquitination and degradation of type-I inositol 1,4,5-trisphosphate receptors (ITPR1) through the endoplasmic reticulum-associated degradation (ERAD) pathway . This process is essential for maintaining calcium homeostasis and regulating cellular signaling pathways. Rnf170 resides in the endoplasmic reticulum (ER) membrane and interacts with ERLIN1/ERLIN2 scaffolds to mediate these functions .

How does the loss of Rnf170 function affect mouse physiology?

Loss-of-function studies using knockout mice have demonstrated that Rnf170 deficiency leads to age-dependent gait abnormalities, reduced proprioception, and thermal nociception sensitivity . These phenotypes mimic autosomal-dominant sensory ataxia (ADSA), a rare genetic disorder associated with Rnf170 mutations in humans. Elevated levels of ITPR1 protein were observed in the cerebellum and spinal cord of Rnf170-deficient mice, suggesting disrupted protein degradation pathways .

What experimental models are available for studying Rnf170?

Several experimental models have been developed to study Rnf170:

  • Knockout Mice: Global Rnf170 knockout mice generated using CRISPR/Cas9 technology provide insights into its physiological roles .

  • Recombinant Proteins: Recombinant mouse Rnf170 proteins are available for in vitro studies, including structural and functional assays .

  • Adenoviral Vectors: Adenoviral constructs expressing mouse Rnf170 are used for overexpression studies in cell culture .

What are the known molecular interactions involving Rnf170?

Rnf170 interacts with ERLIN1/ERLIN2 complexes to mediate ITPR1 ubiquitination . It also forms complexes with TMUB1-L, a long isoform of TMUB1, through conserved luminal domains. These interactions are crucial for clustering proteins in ER membrane nanodomains and regulating ERAD pathways .

What techniques are commonly used to study Rnf170 expression?

The following techniques are widely employed:

  • Western Blotting: Detects Rnf170 protein levels using specific antibodies .

  • ELISA: Quantifies Rnf170 concentrations in tissue homogenates and cell lysates .

  • qPCR: Measures mRNA expression levels of Rnf170 across different tissues .

  • Immunohistochemistry: Localizes Rnf170 within cellular compartments.

How do mutations in the Rnf170 gene contribute to disease?

Mutations in the human RNF170 gene are linked to autosomal-dominant sensory ataxia (ADSA). These mutations disrupt its E3 ubiquitin ligase activity, leading to impaired degradation of ITPR1 and subsequent cellular dysfunction . Mouse models with analogous mutations exhibit similar phenotypes, providing a platform for studying disease mechanisms.

What are the challenges in studying recombinant versus native Rnf170 proteins?

Recombinant proteins may differ from their native counterparts due to variations in post-translational modifications or tertiary structures. For example, ELISA kits optimized for native samples may not reliably detect recombinant proteins unless their sequences and structures closely mimic the native form . Researchers must validate recombinant protein functionality through comparative assays.

How can CRISPR/Cas9 technology be utilized to study Rnf170?

CRISPR/Cas9 can be employed to generate precise genetic modifications, such as:

  • Knockout Models: Deleting the entire coding sequence of Rnf170 to study loss-of-function effects.

  • Point Mutations: Introducing disease-associated mutations to investigate their impact on protein function.

  • Reporter Constructs: Tagging the endogenous gene with fluorescent markers for live-cell imaging.

These approaches enable detailed functional analyses of Rnf170 in both in vitro and in vivo systems .

How does Rnf170 regulate calcium signaling via ITPR1?

Rnf170 ubiquitinates ITPR1 receptors on the ER membrane, targeting them for proteasomal degradation via the ERAD pathway. This regulation prevents excessive calcium release from the ER, maintaining intracellular calcium homeostasis. Dysregulation of this process due to Rnf170 mutations can lead to pathological conditions such as ADSA .

What bioinformatics tools can be used to analyze Rnf170 structure and interactions?

Several computational tools facilitate structural and interaction studies:

  • AlphaFold Multimer: Predicts three-dimensional structures of protein complexes involving Rnf170 and its interacting partners .

  • STRING Database: Identifies potential protein-protein interactions based on experimental and computational evidence.

  • Molecular Docking Software: Simulates binding interactions between Rnf170 and small molecules or other proteins.

These tools complement experimental approaches by providing mechanistic insights into Rnf170 functions.

How should controls be incorporated into experiments involving recombinant Rnf170?

Appropriate controls include:

  • Negative Controls: Cells transfected with empty vectors or treated with non-specific siRNA.

  • Positive Controls: Overexpression of wild-type or mutant forms of Rnf170.

  • Loading Controls: Housekeeping genes or proteins (e.g., GAPDH) for normalization in Western blot or qPCR experiments.

These controls ensure data reliability and reproducibility.

What factors influence the stability of recombinant Rnf170 proteins during storage?

Recombinant proteins should be stored at -20°C or -80°C in buffers containing stabilizing agents like glycerol or reducing agents like DTT . Repeated freeze-thaw cycles should be avoided to prevent protein degradation or aggregation.

How can discrepancies between different ELISA kits for Rnf170 be resolved?

Discrepancies may arise due to differences in antibody specificity, assay sensitivity, or sample preparation protocols. Researchers should:

  • Validate kits using known concentrations of recombinant or native proteins.

  • Optimize sample dilutions to fall within the linear range of detection.

  • Compare results across multiple kits under identical conditions .

How should contradictory data on Rnf170 expression levels be addressed?

Contradictory findings may result from variations in experimental conditions, such as tissue type, developmental stage, or detection methods. To resolve these issues:

  • Perform independent validation using complementary techniques (e.g., Western blotting vs qPCR).

  • Standardize sample preparation protocols across experiments.

  • Collaborate with other laboratories to cross-check findings.

What statistical methods are suitable for analyzing data from Rnf170 studies?

Commonly used statistical tests include:

  • t-tests: For comparing means between two groups.

  • ANOVA: For analyzing differences among multiple groups.

  • Regression Analysis: To examine relationships between variables (e.g., gene expression vs phenotype severity).

Data should be presented with appropriate measures of central tendency (mean/median) and variability (standard deviation/error).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.