Recombinant Mouse RING finger protein 223 (Rnf223)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse RING finger protein 223 (Rnf223) is a protein-coding gene in mice, also referred to as RN223 . Rnf223 belongs to the E3 ubiquitin ligase family, which is involved in transferring ubiquitin to protein substrates . This process is critical for regulating various cellular functions, including cell growth and migration . Recent studies indicate that Rnf223 plays a significant role in cancer, particularly in pancreatic cancer, and may serve as a prognostic marker .

Basic Information

PropertyDescription
Gene NameRnf223 (Ring Finger Protein 223)
FunctionE3 ubiquitin ligase involved in transferring ubiquitin to protein substrates
Associated DiseasesCongenital Myasthenic Syndrome
ExpressionHigher expression observed in specific clinical parameters such as male gender, high alcohol consumption, ductal/lobular neoplasms, pathological stage N0, tumor stage IIa, and deceased individuals in pancreatic cancer patients
Subcellular LocalizationCytosol and perinuclear space
Molecular WeightThe related protein RNF213 has a molecular weight of 591 kDa .
StructureContains a C3HC4-type RING finger domain and an E3 ubiquitin ligase domain .
ActivitiesThe related protein RNF213 has both AAA+ adenosine triphosphatase (ATPase) and ubiquitin ligase activities .

Rnf223 in Pancreatic Cancer

  1. Prognostic Marker: Rnf223 has been identified as an independent prognostic marker in pancreatic cancer (PC) . Multivariate analysis of differentially expressed genes (DEGs) in The Cancer Genome Atlas (TCGA) pancreatic adenocarcinoma dataset revealed that Rnf223 exhibits prognostic significance .

  2. Correlation with Clinical Parameters: Expression analysis indicates that Rnf223 is significantly higher in specific clinical parameters, including male patients, those with high alcohol consumption, ductal/lobular neoplasms, pathological stage N0, tumor stage IIa, and deceased individuals .

  3. Impact on Cell Growth and Migration: Functional assays using pancreatic cancer cell lines (ASPC-1 and PANC-1) demonstrated that silencing Rnf223 inhibits cancer cell growth and migration . Knockdown of Rnf223 significantly reduced cell numbers and migration distances in these cell lines .

  4. Affected Pathways: Quantitative proteomics analysis has revealed that RNF223 knockdown in ASPC-1 cells affects several pathways and biological processes . The most enriched pathways include oxidative phosphorylation, regulation of the cytoskeleton, pathways in cancer, and metabolic pathways . Gene Ontology (GO) analysis showed enrichment in metabolism-related biological processes and cell cycle processes .

Functional Analysis and Silencing of Rnf223

  1. Silencing Efficiency: The silencing efficiency of Rnf223 was examined using qRT-PCR after transfection with Rnf223-targeting shRNA . shRNA2 consistently showed higher knockdown efficiency (>50%) and was used for subsequent experiments .

  2. Effects on Proliferation and Migration: CCK8 and wound healing assays were used to assess the impact of Rnf223 silencing on the proliferation and migration capacity of ASPC-1 and PANC-1 cells . Results indicated that Rnf223 knockdown significantly reduces cell proliferation and migration in both cell lines .

Rnf223 and Other Cancers

  1. Endometrial Cancer: Mutation sites in RNF223 have been associated with age, International Federation of Gynecology and Obstetrics stage, and histology in sporadic and Lynch syndrome–associated endometrial cancer .

  2. Uterine Sarcoma: RNF223 has been reported as a prognostic marker for uterine sarcoma .

Rnf213 as an Antimicrobial Host Determinant

  1. RNF213 Function: Ring finger protein 213 (RNF213) is a large E3 ubiquitin ligase associated with moyamoya disease, a rare cerebrovascular condition . RNF213 contains a C3HC4-type RING finger domain with an E3 ubiquitin ligase domain and six AAA+ adenosine triphosphatase (ATPase) domains .

  2. Antimicrobial Activity: Recent studies have highlighted the role of RNF213 in combating microbial infections, including viruses, parasites, bacteria, and chlamydiae . RNF213 functions as a sensor for ISGylated proteins and exhibits broad antimicrobial activity in vitro and in vivo .

RNF219 and Inflammatory Responses

  1. RNF219 Function: Ring finger protein 219 (RNF219) contains a C3HC4-type RING-HC motif and has been identified as a binding partner of sirtuin 1 (SIRT1) .

  2. Regulation of SIRT1: RNF219 binds to SIRT1, inhibiting its degradation by preventing ubiquitination, which prolongs SIRT1-mediated anti-inflammatory signaling . The acetylation status of RNF219 is a critical determinant in its interaction with SIRT1, affecting the response to inflammatory stimuli .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
Rnf223; RING finger protein 223
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-285
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rnf223
Target Protein Sequence
MVHKKRGGVTSWLFRKSPVHNVLPLLHSWESCHQATGCGVQLCHPTARTAPQPQCPGPLA QGAAPSPSTPGSVKVASPLECSICFSGYDNIFKTPKELSCSHVFCLECLARLAAAQPAGR SGREAVPCPFCRQPTTVPVAGAPALRTSRQLQAKLPAHLQREEPVWLEGTKLCCRPLPTT SGQEDGGFVSVDVGLSKPAEPTLPVPVQDPAPNPGWLARCWARFRDWRRVALVSVLLLVL FCVILWPVQCALKTGNLRCINRPPAATATATVTTDALSFGVLANN
Uniprot No.

Target Background

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Rnf223 and what are its fundamental cellular functions in mouse models?

    Rnf223 belongs to the RING finger protein family, which typically function as E3 ubiquitin ligases. These enzymes transfer activated ubiquitin from ubiquitin-conjugating enzymes (E2) to protein substrates, conferring substrate specificity in the ubiquitination pathway . While mouse-specific Rnf223 data is limited, research on human RNF223 indicates involvement in metabolic regulation and potential roles in cell growth and migration. In experimental systems, functional assays of RNF223 silencing have revealed its role as a tumor-promoting gene that may regulate cancer cell metabolism . Researchers should characterize mouse Rnf223 through both in vitro ubiquitination assays and cellular functional studies to determine if these functions are conserved across species.

  • How does mouse Rnf223 compare structurally and functionally to human RNF223?

    Comparative analysis should begin with sequence alignment to identify conserved domains, particularly the catalytic RING domain that coordinates zinc ions and is essential for E3 ligase activity. While specific comparative data is not provided in the search results, researchers should note that human RNF223 has been identified as a prognostic marker in pancreatic cancer . To establish functional conservation, parallel knockdown experiments in both mouse and human cell lines can determine if Rnf223 regulates similar pathways across species. Expression profiling across tissues and developmental stages in both species will further clarify conserved and divergent aspects of Rnf223 biology.

  • What are the optimal expression systems for producing functional recombinant mouse Rnf223?

    Production of functional recombinant Rnf223 requires careful consideration of expression systems to maintain the integrity of the RING finger domain. For prokaryotic expression (E. coli), induction at lower temperatures (16-20°C) often improves proper folding of RING domain proteins. Buffer supplementation with zinc is frequently necessary since the RING domain coordinates zinc ions. For eukaryotic expression, mammalian cell lines (HEK293, CHO) or insect cell systems (Sf9, High Five) typically yield properly folded protein with native post-translational modifications. Regardless of system, purification strategies should include affinity chromatography (His-tag, GST-tag) followed by size-exclusion chromatography. Functional activity validation through in vitro ubiquitination assays is essential before using the recombinant protein in downstream applications.

Advanced Research Questions

  • What are the best methods for identifying and validating Rnf223 substrates in mouse experimental systems?

    Substrate identification for E3 ubiquitin ligases like Rnf223 requires a multi-faceted approach. Based on studies with RNF223 in pancreatic cancer, researchers should first perform quantitative proteomics comparing wild-type to Rnf223-silenced cells to identify proteins with altered abundance . This approach can identify metabolism-related proteins that may represent substrates, as RNF223 has been shown to affect metabolism-related pathways . Follow-up validation should include:

    • Co-immunoprecipitation to confirm physical interaction

    • In vitro ubiquitination assays with purified components

    • In-cell ubiquitination assays comparing wild-type and mutant Rnf223

    • Protein stability assays following Rnf223 manipulation

    • Mutational analysis of putative ubiquitination sites on candidate substrates

  • How can researchers effectively design and validate Rnf223 knockdown or knockout models?

    Based on research with human RNF223, effective gene silencing strategies should include:

    • ShRNA-mediated knockdown: Design multiple targeting sequences and validate knockdown efficiency by qRT-PCR. In studies of RNF223 in pancreatic cancer cell lines, shRNA2 achieved >50% knockdown efficiency and was selected for functional studies .

    • CRISPR-Cas9 knockout: Design guide RNAs targeting critical exons, particularly those encoding the RING finger domain. Validate knockout by genomic sequencing and protein expression analysis.

    • Conditional systems: For in vivo mouse studies, consider Cre-loxP systems for tissue-specific or inducible deletion to avoid potential developmental effects.

    Phenotypic validation should assess cell proliferation and migration using established assays such as CCK8 for proliferation and wound healing assays for migration, as these parameters were affected by RNF223 knockdown in human cancer cell lines .

  • What role does Rnf223 play in mouse models of cancer and other diseases?

    Studies on human RNF223 demonstrate its significance as an independent unfavorable prognostic marker in pancreatic cancer . RNF223 silencing significantly reduced cell proliferation and decreased migration in pancreatic cancer cell lines (ASPC-1 and PANC-1) . To investigate mouse Rnf223 in disease models:

    • Generate Rnf223 overexpression and knockout mouse models

    • Analyze Rnf223 expression in genetically engineered mouse cancer models

    • Perform xenograft studies with Rnf223-manipulated mouse cancer cells

    • Investigate metabolic phenotypes, as RNF223 has been associated with metabolism-related pathways

    • Examine the correlation between Rnf223 expression and disease progression parameters

  • How do transcription factors regulate Rnf223 expression in mouse tissues?

    In human pancreatic cancer, KLF4 has been identified as a transcription factor that contributes to the increased expression of RNF223 . ChIP sequencing data revealed a prominent KLF4 peak in the promoter region of RNF223 DNA, and coexpression analysis showed a strong correlation coefficient (R = 0.51) between KLF4 and RNF223 . For mouse Rnf223 regulation studies:

    • Perform in silico analysis of the mouse Rnf223 promoter region to identify conserved transcription factor binding sites

    • Validate transcription factor binding using ChIP-PCR or ChIP-seq

    • Perform reporter assays with wild-type and mutated promoter constructs

    • Manipulate expression of candidate transcription factors and measure effects on endogenous Rnf223 levels

    • Compare regulatory mechanisms between mouse and human systems to identify conserved controls

  • What protein-protein interactions are critical for Rnf223 function?

    As an E3 ubiquitin ligase, Rnf223 likely interacts with specific E2 conjugating enzymes and various substrate proteins. To map the Rnf223 interactome:

    • Perform immunoprecipitation followed by mass spectrometry

    • Use proximity labeling techniques (BioID, APEX) to identify proteins in close spatial proximity to Rnf223

    • Apply yeast two-hybrid screening to identify direct binding partners

    • Conduct domain mapping studies to identify regions essential for specific interactions

    • Validate key interactions through co-immunoprecipitation, FRET, or pull-down assays

    Special attention should be given to interactions with metabolic enzymes or regulators, as RNF223 has been implicated in metabolic regulation in cancer cells .

Methodological Questions

  • What are the best methods for analyzing Rnf223 E3 ligase activity in vitro?

    To assess the enzymatic activity of recombinant mouse Rnf223:

    • Reconstitution assays: Combine purified E1, appropriate E2(s), ubiquitin, ATP, and recombinant Rnf223 to measure auto-ubiquitination as a baseline for activity.

    • Substrate ubiquitination assays: Once potential substrates are identified, include purified substrate proteins in the reconstitution system.

    • Controls should include reactions lacking ATP, using catalytically inactive Rnf223 mutants, and testing with various E2 enzymes to determine specificity.

    • Detection methods include Western blotting for qualitative analysis and mass spectrometry for quantitative and site-specific ubiquitination assessment.

    Both mono- and poly-ubiquitination should be evaluated, as different types of ubiquitin chains signal different cellular fates for substrates.

  • How can researchers accurately quantify Rnf223 expression in mouse tissue samples?

    For reliable quantification of Rnf223 in mouse tissues:

    • RNA analysis: Design specific qRT-PCR primers spanning exon-exon junctions to avoid genomic amplification. In RNF223 studies, researchers examined expression efficiency using qRT-PCR after shRNA transfection .

    • Protein analysis: Use validated antibodies for Western blotting, with recombinant Rnf223 and Rnf223-knockout samples as positive and negative controls.

    • Normalization: For qRT-PCR, use multiple reference genes (GAPDH, β-actin) for robust normalization.

    • Spatial analysis: Complement bulk tissue analysis with in situ hybridization or immunohistochemistry to determine cell-type specific expression.

    • Single-cell approaches: Consider single-cell RNA-seq for heterogeneous tissues to reveal cell population-specific expression patterns.

  • What cell-based assays are most informative for studying Rnf223 function?

    Based on studies with human RNF223, effective functional assays include:

    • Proliferation assays: CCK8 assay was effective in demonstrating that RNF223 knockdown significantly reduced cell numbers in pancreatic cancer cell lines .

    • Migration assays: Wound healing assays showed that RNF223 knockdown decreased migration ability in cancer cell lines .

    • Metabolism assays: Since RNF223 may regulate cancer cell metabolism, assays measuring glucose uptake, lactate production, oxygen consumption, and extracellular acidification rates would be informative.

    • Protein stability assays: Cycloheximide chase experiments to determine if Rnf223 affects the half-life of putative substrate proteins.

    • Subcellular localization: Immunofluorescence to determine where Rnf223 functions within the cell.

  • How does post-translational modification affect Rnf223 activity and stability?

    E3 ubiquitin ligases including RING finger proteins are often regulated by post-translational modifications. To investigate modifications of mouse Rnf223:

    • Mass spectrometry analysis of purified Rnf223 to identify modification sites (phosphorylation, ubiquitination, SUMOylation)

    • Site-directed mutagenesis of modified residues to determine functional significance

    • Treatment with phosphatase inhibitors, deubiquitinating enzymes, or kinase inhibitors to manipulate modification states

    • Analysis of modification patterns under different cellular conditions (growth factor stimulation, stress, cell cycle phases)

    Particular attention should be paid to modifications within or near the RING finger domain that might directly impact catalytic activity.

  • What strategies can researchers use to develop specific inhibitors or activators of Rnf223?

    Development of Rnf223-targeted compounds requires:

    • Structural characterization: Obtain crystal or NMR structures of the Rnf223 RING domain and substrate-binding regions.

    • High-throughput screening: Develop fluorescence-based ubiquitination assays amenable to compound library screening.

    • Structure-based design: Use in silico modeling to design compounds targeting critical interfaces:
      a) The E2-binding surface of the RING domain
      b) Substrate recognition sites
      c) Protein-protein interaction domains

    • Validation in cell-based systems: Test compounds for specificity against other RING E3 ligases and for efficacy in modulating Rnf223-dependent cellular processes.

    Given RNF223's potential role in cancer progression , inhibitors could have therapeutic relevance if the oncogenic function is conserved in mouse models.

Data Tables and Research Findings

Cell LineManipulationEffect on ProliferationEffect on MigrationEffect on MetabolismReference
ASPC-1RNF223 knockdownSignificantly reducedReduced migration distanceAltered metabolic pathways
PANC-1RNF223 knockdownSignificantly reducedReduced migration distanceAltered metabolic pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.