Recombinant Mouse RING finger protein 24 (Rnf24)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Context

Recombinant Mouse RNF24 is a synthetic version of the naturally occurring RING finger protein 24 (Rnf24), engineered for research purposes. Native RNF24 belongs to the transmembrane RING finger protein family, characterized by its role in ubiquitination-dependent processes, including protein trafficking, degradation, and cell signaling . The recombinant form is often expressed in bacterial (e.g., E. coli) or mammalian systems (e.g., HEK293 cells) to maintain structural and functional fidelity .

Amino Acid Composition

Recombinant Mouse RNF24 spans residues 1–148, with a molecular weight of ~16.8 kDa (excluding tags) . Key features include:

  • RING finger domain: Critical for E3 ubiquitin ligase activity .

  • Transmembrane domains: Integral for membrane localization .

ParameterValue/DescriptionSource
Expression RegionFull-length (1–148 amino acids)
TagHis-tag (common in bacterial systems)
Storage BufferTris-based buffer with 50% glycerol

Functional Roles

RNF24 regulates:

  • Protein trafficking: Modulates intracellular transport of receptors (e.g., TRPC channels) .

  • Ubiquitination: Acts as an E3 ligase in the ubiquitin-proteasome system .

  • Golgi apparatus integrity: Maintains organelle structure and function .

Expression Systems

SystemHost OrganismAdvantagesLimitations
Bacterial (e.g., E. coli)E. coliHigh yield, cost-effectivePotential improper folding
Mammalian (e.g., HEK293)Human cellsNative folding and post-translational modificationsHigher production costs

Recombinant RNF24 is purified via affinity chromatography (e.g., Protein A/G for IgG-tagged proteins) .

Quality Control

  • Purity: >95% by SDS-PAGE .

  • Activity Assays: ELISA-based validation for antibody binding (e.g., anti-RNF24 monoclonal antibodies) .

Experimental Uses

ApplicationDescriptionExample Studies
Protein Trafficking StudiesInvestigating RNF24’s role in receptor internalization (e.g., TRPC channels) .
Osteoporosis ModelsAnti-RNF24 antibodies mitigate bone loss in ovariectomized mice .
Antibody ValidationELISA kits for detecting native RNF24 in mouse tissues/lysates .

Key Findings

  1. Osteoporosis Treatment:

    • Anti-RNF24 antibodies (100 mg/kg) partially reverse osteoporosis progression in OVX mice by preserving bone density .

    • RNF24 expression is elevated in monocytes during osteoporosis, suggesting a mechanistic role in immune-cell-mediated bone resorption .

  2. Regulatory Factors:

    • Inducers: Clofibrate, beta-naphthoflavone, and valproic acid upregulate RNF24 mRNA .

    • Inhibitors: Bisphenol A, chlorpyrifos, and carbon tetrachloride suppress RNF24 expression .

Regulatory FactorEffect on RNF24 ExpressionModel Organism
ClofibrateMouse
Bisphenol ARat
Valproic Acid↑ (context-dependent)Human

ELISA-Based Detection

Mouse RNF24 ELISA kits enable quantitative analysis of protein levels in biological samples (e.g., lysates, blood) .

  • Sensitivity: 0.156–10 ng/ml .

  • Cross-reactivity: Specific to mouse RNF24; no reported human cross-reactivity .

Therapeutic Implications

  • Bone Diseases: Targeting RNF24 may offer therapeutic avenues for osteoporosis .

  • Cancer Research: RNF24’s role in ubiquitination pathways could inform strategies for modulating protein stability in tumors .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rnf24; RING finger protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-148
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Rnf24
Target Protein Sequence
MSSDFPHYNFRMPNIGFQNLPLNIYIVVFGTAVFVFILSLLFCCYLIRLRHQAHKEFYAY KQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLVKWLEVRKVCPLCNM PVLQLAQLHSKQDRGPPQEPLPGAENIV
Uniprot No.

Target Background

Function
May play a role in the intracellular trafficking of TRPCs.
Database Links
Subcellular Location
Golgi apparatus membrane; Single-pass membrane protein.

Q&A

What is Mouse RING finger protein 24 (Rnf24) and what are its basic characteristics?

Mouse RING finger protein 24 (Rnf24) is a protein encoded by the RNF24 gene (GeneID: 51902) in mice. It belongs to the RING finger protein family, which typically contains zinc-binding domains involved in protein-protein interactions. The protein's UniProt accession number is Q8BGI1 with the entry name RNF24_MOUSE . Rnf24 is commonly studied in tissue homogenates, cell lysates, and other biological fluids to understand its functional characteristics and interactions with other cellular components.

Detection and quantification of Rnf24 typically requires specialized methods such as ELISA (Enzyme-Linked Immunosorbent Assay), which can detect the protein in the concentration range of 0.156 ng/ml to 10 ng/ml, depending on the sensitivity of the detection kit .

What methodologies are recommended for initial characterization of Rnf24 in a new research project?

When initiating research on Rnf24, consider the following methodological approach:

  • Define clear research variables: Establish your independent variable (e.g., experimental conditions affecting Rnf24 expression) and dependent variable (e.g., Rnf24 concentration or activity) .

  • Design a systematic detection protocol: ELISA is a common method for Rnf24 detection. When establishing a new protocol, determine optimal dilutions through titration experiments as the recommended concentrations should be determined by the end user based on specific experimental conditions .

  • Establish appropriate controls: Include both positive and negative controls in your experimental design to validate the specificity of your detection methods .

  • Consider sample preparation variables: Different biological samples (tissue homogenates, cell lysates) may require specific preparation protocols to optimize Rnf24 detection .

  • Formulate research questions using frameworks: Apply the PICO framework (Population/sample, Intervention, Comparison, Outcome) to structure your research questions around Rnf24 .

How should I design a rigorous experiment to study Rnf24 function or expression?

A well-designed experiment studying Rnf24 should follow these key steps:

  • Define your variables precisely: Clearly articulate how Rnf24 fits into your experimental model - is it an independent variable (manipulated) or dependent variable (measured)?

  • Formulate a specific, testable hypothesis: For example, "Treatment with compound X will increase Rnf24 expression in mouse liver cells by at least 50% compared to untreated controls."

  • Control for extraneous variables: Identify potential confounding factors that might influence Rnf24 expression or function (e.g., cell culture conditions, animal age, handling procedures) and implement appropriate controls .

  • Decide on appropriate group assignment: Determine whether a between-subjects design (different treatment groups) or within-subjects design (same subjects under different conditions) is most appropriate for your Rnf24 study .

  • Plan precise measurement protocols: For Rnf24 detection, ensure consistent sample preparation and analysis procedures. When using ELISA, maintain strict temperature control (storing reagents at 4°C as recommended) and consistent procedural timing to minimize performance fluctuations .

  • Apply the FINER criteria: Evaluate whether your research question about Rnf24 is Feasible, Interesting, Novel, Ethical, and Relevant to ensure research value .

What are the most common pitfalls in experimental design when studying Rnf24, and how can they be avoided?

When designing Rnf24 experiments, researchers should be aware of these common pitfalls:

  • Inadequate sample preparation: Rnf24 detection can be compromised by improper sample handling. Ensure samples are prepared according to validated protocols and diluted to mid-range concentrations for accurate results .

  • Failure to consider native vs. recombinant protein differences: Commercial detection kits are often optimized for native Rnf24, which may have different sequences or tertiary structures compared to recombinant variants. This can affect detection efficiency and result interpretation .

  • Overlooking experimental conditions: The stability of Rnf24 detection kits is influenced by storage conditions and handling. Maintaining consistent lab conditions is critical as the loss rate of activity can be up to 5% even within the expiration date under appropriate storage conditions .

  • Insufficient consideration of temporal factors: When studying Rnf24 expression patterns or responses to treatments, carefully plan the timing of interventions and measurements to capture relevant biological processes .

  • Neglecting feasibility assessment: Before initiating extensive Rnf24 research, ensure you have adequate resources, including funding, time, expertise, and access to necessary equipment for protein detection and analysis .

What methodological considerations are important when comparing native versus recombinant Rnf24 in research applications?

When comparing native versus recombinant Rnf24, researchers should consider these methodological aspects:

  • Detection system optimization: Most commercial detection kits are optimized for native Rnf24 rather than recombinant proteins. The detection efficiency may vary significantly between these forms due to structural differences .

  • Structural characterization: Recombinant Rnf24 may have different tertiary structures compared to the native protein, which can affect antibody binding and detection sensitivity .

  • Sequence variation analysis: Recombinant proteins may contain additional sequences (tags, linkers) or lack post-translational modifications present in native proteins, potentially affecting functional studies .

  • Calibration curve adjustments: When quantifying recombinant Rnf24, standard curves should ideally be generated using the same recombinant protein rather than native standards to ensure accurate concentration determination.

  • Validation with multiple techniques: Confirm findings using complementary detection methods beyond ELISA, such as Western blotting or mass spectrometry, particularly when comparing native and recombinant forms.

How can I troubleshoot inconsistent results in Rnf24 detection and quantification?

When facing inconsistent results in Rnf24 detection, follow this systematic troubleshooting approach:

  • Assess reagent quality and storage conditions: Ensure all components of detection kits are stored according to manufacturer recommendations (typically at 4°C) and have not exceeded their validity period of 6 months .

  • Review sample preparation protocol: Inconsistent results often stem from variability in sample preparation. Standardize homogenization techniques, buffer compositions, and protein extraction procedures.

  • Evaluate dilution factors: Sample concentrations must be diluted to mid-range of the detection kit (between 0.156 ng/ml and 10 ng/ml for typical ELISA kits) for accurate results .

  • Control experimental conditions: Minimize performance fluctuations by standardizing operation procedures and laboratory conditions, ideally having the same researcher perform all assays for a given experiment .

  • Implement standard curve verification: Regularly verify the quality of your standard curves, ensuring they cover the full range of expected Rnf24 concentrations and demonstrate appropriate linearity.

How can I apply the PICO and FINER frameworks to develop strong research questions about Rnf24?

To develop robust research questions about Rnf24, apply these frameworks:

PICO Framework Application:

ComponentDescriptionRnf24 Research Example
Population/SampleDefine the specific biological systemMouse primary hepatocytes expressing Rnf24
InterventionThe experimental manipulationKnockdown of Rnf24 using siRNA
ComparisonThe control or alternative conditionCells treated with scrambled siRNA
OutcomeThe measured effect or resultChanges in cellular stress response pathways

FINER Criteria Application:

  • Feasible: Ensure you have access to required detection methods (ELISA kits with appropriate sensitivity range of 0.156-10 ng/ml) and sample types (tissue homogenates, cell lysates) .

  • Interesting: Connect your Rnf24 research to broader biological questions that engage the scientific community, such as protein degradation pathways or cellular signaling .

  • Novel: Conduct a thorough literature review to identify knowledge gaps about Rnf24 function, regulation, or interaction partners .

  • Ethical: Consider any ethical implications of your research methods, especially when using animal models for Rnf24 studies .

  • Relevant: Align your research with current priorities in the field and potential applications to biological understanding or disease mechanisms .

What sample preparation considerations are critical for accurate Rnf24 detection in different biological specimens?

Accurate detection of Rnf24 across different biological specimens requires careful attention to sample preparation:

  • Tissue homogenates: When processing tissue samples for Rnf24 detection:

    • Use appropriate buffer compositions that maintain protein stability

    • Standardize homogenization methods (mechanical disruption, sonication) to ensure consistent extraction efficiency

    • Centrifuge samples at recommended speeds to remove cellular debris without losing target protein

  • Cell lysates: For cultured cells expressing Rnf24:

    • Select lysis buffers compatible with downstream detection methods

    • Maintain consistent cell numbers across experimental groups

    • Consider detergent types and concentrations that effectively solubilize membrane-associated proteins without interfering with antibody binding

  • Biological fluids: When analyzing Rnf24 in serum, plasma, or other fluids:

    • Account for matrix effects that may interfere with detection

    • Determine optimal dilution factors empirically to bring concentrations within the detection range (0.156-10 ng/ml)

    • Consider filtration or pre-clearing steps to remove interfering substances

  • Storage considerations: Across all sample types:

    • Minimize freeze-thaw cycles as they can degrade proteins

    • Store processed samples according to validated protocols to maintain Rnf24 stability

    • Document storage conditions and durations to account for potential variability in detection

What statistical approaches are most appropriate for analyzing Rnf24 expression or activity data?

When analyzing Rnf24 expression or activity data, consider these statistical approaches:

  • Descriptive statistics: Calculate means, standard deviations, and coefficients of variation to assess the central tendency and dispersion of your Rnf24 measurements. This is particularly important given that ELISA-based detection methods for Rnf24 have specific test ranges (0.156-10 ng/ml) and variation should be monitored .

  • Hypothesis testing: Select appropriate statistical tests based on:

    • Data distribution (parametric vs. non-parametric)

    • Number of experimental groups (t-tests for two groups; ANOVA for multiple groups)

    • Study design (paired vs. unpaired analyses)

  • Correlation and regression analyses: When examining relationships between Rnf24 levels and other biological variables, use:

    • Pearson's or Spearman's correlation coefficients to assess strength of associations

    • Simple or multiple regression to model relationships between variables

  • Power analysis: Conduct a priori power calculations to determine appropriate sample sizes for detecting biologically meaningful changes in Rnf24 levels, accounting for expected variability in the assay.

  • Multiple testing correction: When analyzing Rnf24 across multiple conditions or timepoints, implement appropriate corrections (Bonferroni, Benjamini-Hochberg) to control false discovery rates.

How can I validate my findings about Rnf24 to ensure reproducibility and reliability?

To ensure reproducibility and reliability of Rnf24 research findings:

  • Use multiple detection methods: Complement ELISA results with alternative techniques such as Western blotting, immunofluorescence, or mass spectrometry to confirm Rnf24 levels or localization.

  • Implement rigorous controls: Include positive and negative controls in all experiments, and consider using biological replicates from independent sources to verify findings.

  • Standardize experimental conditions: Document and maintain consistent protocols for sample preparation, storage, and analysis. The stability of Rnf24 detection can be affected by experimental conditions, with activity loss rates of up to 5% even under appropriate storage conditions .

  • Conduct replication studies: Perform independent replications of key experiments, ideally by different researchers, to confirm reproducibility of Rnf24 findings.

  • Apply the same user throughout: To minimize performance fluctuations in Rnf24 detection, it is strongly recommended that the same researcher performs all assays within a study .

  • Document methodology comprehensively: Provide detailed methods sections in publications, including specific information about:

    • Sample preparation procedures

    • Detection kit specifications (sensitivity range, lot numbers)

    • Data analysis approaches

    • Potential limitations of the methods employed

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.