Recombinant Mouse S-adenosylmethionine mitochondrial carrier protein (Slc25a26)

Shipped with Ice Packs
In Stock

Description

2.1. Substrate Specificity and Transport Mechanism

SLC25A26 operates via an antiport mechanism:

SubstrateDirectionRole
SAMMitochondrial matrix → cytosolPrimary methyl donor for methylation reactions
SAHCytosol → mitochondrial matrixBy-product of SAM-dependent methylation

This exchange is critical for maintaining mitochondrial SAM levels, which are essential for:

  • tRNA/rRNA methylation (stabilizing mitochondrial translation machinery)

  • Protein methylation (e.g., electron transfer flavoprotein β, ATP/ADP translocases)

  • Lipoic acid synthesis (required for pyruvate dehydrogenase and α-KGDH complexes)

3.1. Mitochondrial Disorders

Pathogenic Slc25a26 mutations cause mitochondrial diseases characterized by:

PhenotypeMechanismClinical Features
Neonatal-onsetImpaired SAM transport →Lactic acidosis, respiratory failure, multi-organ dysfunction
Late-onsetDefective SAH export →Exercise intolerance, myopathy, recurrent metabolic decompensation

Biochemical Hallmarks:

  • Deficiency in CoQ10 and lipoic acid synthesis

  • Reduced complex I/IV activity in respiratory chain

  • Hypomethylation of mitochondrial RNA/proteins

3.2. Cancer-Associated Dysregulation

SLC25A26 expression varies across cancers:

Cancer TypeExpression PatternFunctional Impact
Cervical cancerDownregulated (promoter hypermethylation)Enhanced cytosolic SAM → methionine cycle activation → reduced ROS
Low-grade gliomaUpregulated (risk allele rs11706832-C)Increased mitochondrial SAM → mtDNA hypermethylation → reduced ATP
Colorectal cancerOverexpressedTumor growth promotion (knockdown causes tumor regression)

4.1. Research Tools

ApplicationMethodSource
Western blottingDetection in human placenta/skeletal muscleRabbit monoclonal antibody (EPR11581)
ELISAQuantification of protein levelsStrep-tagged recombinant protein
Functional assaysSAM/SAH transport kineticsReconstituted proteoliposomes

4.2. Experimental Models

  • Mouse oocytes: Overexpression mimics aging, reducing maturation rate and increasing ROS

  • Drosophila melanogaster: SAMC knockout models for mitochondrial disease studies

5.1. Expression Systems

HostTagYieldPurity
E. coliHis-tagHighNi-NTA affinity chromatography
HEK293Avi-tagModerateBiotin-streptavidin pulldown
TobaccoStrep-tagVariableStrep-Tactin affinity chromatography

5.2. Functional Validation

Recombinant SLC25A26 is validated via:

  1. Transport Activity: SAM/SAH exchange in proteoliposomes

  2. Mitochondrial Localization: GFP fusion assays in yeast/mammalian cells

  3. Phenotypic Rescue: SAM-dependent biotin synthesis in Saccharomyces cerevisiae mutants

Research Gaps and Future Directions

  1. Therapeutic Targeting: Exploring SLC25A26 modulators for cancer/metabolic disorders

  2. Structural Biology: High-resolution crystallography to map substrate-binding sites

  3. Biomarker Potential: Plasma SLC25A26 levels in major depression (elevated in patients)

This protein remains a critical tool for elucidating mitochondrial methylation dynamics and developing precision therapies.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc25a26; Samc; S-adenosylmethionine mitochondrial carrier protein; Mitochondrial S-adenosylmethionine transporter; Solute carrier family 25 member 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a26
Target Protein Sequence
MDAPGFTASLVAGGVAGVSVDLILFPLDTIKTRLQSPQGFNKAGGFRGIYAGVPSAAVGS FPNAAAFFLTYEYVKSLLHTDSTSHFKPVKHMLAASTGEVVACLIRVPSEVVKQRAQVSA SSKTLQIFLTILSEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWAWRRGHVVDSW QSAVCGAFAGGFAAAVTTPLDVAKTRIMLAKAGSSTAVGNVLSAMHGVWRSQGLAGLFAG VLPRMAAISMGGFIFLGAYDQARSLLLEVGRKSP
Uniprot No.

Target Background

Function
Mitochondrial solute carriers transport metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. Specifically, Slc25a26 mediates the transport of S-adenosylmethionine (SAM) into the mitochondria.
Database Links

KEGG: mmu:67582

UniGene: Mm.280725

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic function of mouse Slc25a26 protein in mitochondria?

Mouse Slc25a26 functions as a mitochondrial S-adenosyl-L-methionine/S-adenosyl-L-homocysteine antiporter. It mediates the exchange of cytosolic S-adenosyl-L-methionine (SAM), the predominant methyl-group donor for macromolecule methylation processes, for mitochondrial S-adenosylhomocysteine (SAH), a by-product of methylation reactions . This exchange is crucial for maintaining methylation processes within the mitochondria, which affect mitochondrial RNA stability, protein synthesis, and the biosynthesis of essential cofactors like lipoic acid (LA) and coenzyme Q10 (CoQ10) . The protein is embedded in the inner mitochondrial membrane and belongs to the mitochondrial carrier family (MCF), characterized by a tripartite structure of approximately 300 amino acids, six transmembrane regions, and three repeated MCF signature motifs .

How does Slc25a26 differ structurally from other members of the SLC25 family?

While Slc25a26 shares the canonical structure of SLC25 family members with six transmembrane domains and the characteristic P-X-[DE]-X-X-[RK] motif repeated three times , it has unique substrate specificity for SAM/SAH exchange. Unlike other family members such as the ADP/ATP carriers (ANTs) or the uncoupling proteins (UCPs), Slc25a26 has evolved specific binding sites for the adenosyl moieties and methionine-derived structures of its substrates. The protein has a predicted molecular weight of 29 kDa based on Western blot analysis . Compared to other SLC25 family members like SLC25A24 (calcium-binding mitochondrial carrier protein) or SLC25A37 (mitoferrin 1), which transport different substrates such as ATP-Mg²⁺ or Fe²⁺ respectively, Slc25a26 has a unique evolutionary relationship with yeast SAM5, suggesting functional conservation across species .

What are the most reliable methods for detecting Slc25a26 expression in mouse tissues?

For detecting Slc25a26 in mouse tissues, Western blot analysis using specific antibodies is the most commonly employed method. Commercially available antibodies such as rabbit recombinant monoclonal antibodies have been validated for this purpose . When performing Western blot, researchers should expect a band at approximately 29 kDa, as confirmed with human tissue samples . Tissue lysate preparation is critical—samples from mitochondria-rich tissues like skeletal muscle yield better results.

For gene expression analysis, quantitative RT-PCR with specific primers targeting conserved regions of Slc25a26 mRNA is recommended. RNA isolation must be performed with high-quality extraction methods to preserve mitochondrial transcripts. Immunohistochemistry can also be employed, though careful optimization of fixation protocols is necessary due to the mitochondrial localization of the protein.

For functional studies, transport assays using isolated mitochondria and radiolabeled SAM can directly measure transport activity, providing insights beyond mere expression levels .

What is the tissue distribution pattern of Slc25a26 in mice, and how does it compare to humans?

Slc25a26 shows a varied expression pattern across mouse tissues, with highest levels typically found in metabolically active tissues. Based on the available research:

Tissue TypeRelative Expression Level in MiceComparable Human Expression
Skeletal MuscleHighHigh
HeartHighHigh
LiverModerate to HighModerate
BrainModerateModerate
PlacentaNot extensively studied in miceHigh
OocytesPresent with functional significanceNot extensively characterized

In mouse oocytes, Slc25a26 has been specifically studied and shown to play an important role in determining oocyte quality through regulation of mitochondrial functions . The tissue distribution reflects the critical role of SAM-dependent methylation in tissues with high energy demands and active metabolism. Similar to humans, mouse Slc25a26 appears to be ubiquitously expressed but with tissue-specific regulation patterns, suggesting conserved physiological roles between species .

What are the recommended protocols for producing functional recombinant mouse Slc25a26 protein?

Production of functional recombinant mouse Slc25a26 requires careful consideration of the protein's membrane-bound nature. The following stepwise approach is recommended:

  • Expression System Selection: Mammalian expression systems (e.g., HEK293 cells) are preferred over bacterial systems to ensure proper folding and post-translational modifications .

  • Vector Design:

    • Include a cleavable tag (His, Avi, or Fc) for purification

    • Consider using codon-optimized sequences for enhanced expression

    • Include appropriate targeting sequences to ensure mitochondrial localization during expression

  • Membrane Protein Solubilization:

    • Use mild detergents such as digitonin, DDM, or LMNG to maintain protein structure

    • Optimize detergent concentration through small-scale extractions

  • Purification Strategy:

    • Employ affinity chromatography utilizing the fusion tag

    • Follow with size exclusion chromatography to ensure homogeneity

    • Maintain detergent above critical micelle concentration throughout

  • Functional Validation:

    • Reconstitute purified protein into liposomes

    • Perform transport assays using radiolabeled SAM substrates

    • Verify exchange activity with SAH

For researchers without specialized membrane protein facilities, commercial sources offer recombinant mouse Slc25a26 proteins produced in various expression systems including mammalian cells .

What methods are most effective for studying Slc25a26 transport activity in experimental models?

Studying the transport activity of Slc25a26 requires approaches that can measure the exchange of SAM and SAH across the mitochondrial membrane:

  • Isolated Mitochondria Assays:

    • Prepare mitochondria from relevant tissues (liver, muscle) or cell models

    • Incubate with radiolabeled SAM (³⁵S-labeled)

    • Measure uptake kinetics and competition with unlabeled substrates

    • This method allows determination of Km and Vmax values for transport

  • Liposome Reconstitution Assays:

    • Reconstitute purified Slc25a26 into liposomes

    • Perform counter-exchange experiments with labeled substrates

    • Advantage: defined system without interference from other transporters

  • Cellular Models with Altered Expression:

    • Generate knockout/knockdown or overexpression systems

    • Measure changes in mitochondrial SAM/SAH levels using LC-MS/MS

    • Correlate with mitochondrial methylation status

  • Genetic Complementation in Model Organisms:

    • Use yeast mutants lacking SAM5 (yeast homolog) for complementation studies

    • Human or mouse Slc25a26 can rescue the phenotype if functionally equivalent

Mouse models have revealed that genetic deletion of Slc25a26 is embryonically lethal, highlighting its essential function, while overexpression of Slc25a26 in oocytes mimics natural aging and impairs mitochondrial function, demonstrating the importance of proper expression levels .

How do mutations in mouse Slc25a26 affect mitochondrial function and disease phenotypes?

Mutations in mouse Slc25a26 profoundly impact mitochondrial function through several interconnected mechanisms:

  • Impaired SAM/SAH Exchange: The primary defect leads to altered mitochondrial methylation capacity, affecting numerous downstream processes .

  • Respiratory Chain Deficiencies: Studies have shown that Slc25a26 mutations result in marked respiratory chain deficiencies, similar to those observed in human cases with biallelic SLC25A26 variants . This manifests as:

    • Decreased activity of respiratory complexes

    • Reduced oxygen consumption

    • Increased production of reactive oxygen species (ROS)

    • Compromised ATP synthesis

  • Mitochondrial Histopathological Abnormalities: These include:

    • Abnormal mitochondrial morphology

    • Altered cristae structure

    • Mitochondrial proliferation as a compensatory mechanism

  • Molecular Consequences:

    • Disrupted mitochondrial RNA stability

    • Impaired protein synthesis within mitochondria

    • Defects in lipoic acid and CoQ10 biosynthesis

    • Affected TCA cycle and mitochondrial oxidative respiratory chain

The disease phenotypes in mice mirror aspects of human mitochondrial disease COXPD28 (combined oxidative phosphorylation deficiency 28). Complete knockout of Slc25a26 in mice is embryonically lethal, demonstrating its essential role in development .

Interestingly, research has shown different pathomechanisms based on the type of transport defect. While impaired SAM transport causes severe neonatal-onset disease, defects in SAH transport lead to milder, late-onset phenotypes, as demonstrated in mouse and fruit fly models .

What is the role of Slc25a26 in cancer progression based on mouse models?

Mouse models have revealed complex and context-dependent roles for Slc25a26 in cancer progression:

  • Differential Expression Patterns:

    • Similar to human cancers, mouse models show altered Slc25a26 expression in various tumors

    • Both downregulation and upregulation have been observed, suggesting tissue-specific effects

  • Functional Consequences of Altered Expression:

    • Downregulation: Lower Slc25a26 expression reduces mitochondrial SAM uptake, increasing cytosolic SAM concentration. This promotes GSH synthesis, polyamine synthesis, and upregulates mitochondrial respiratory enzymes—changes that benefit cancer cell growth, survival, proliferation, migration, and invasion .

    • Upregulation: Conversely, higher Slc25a26 expression increases mitochondrial SAM uptake and decreases cytosolic SAM. This reduces GSH and polyamine synthesis while downregulating mitochondrial respiratory enzymes, leading to senescence, apoptosis, cell cycle arrest, and inhibited growth, proliferation, migration, and invasion of cancer cells .

  • Experimental Evidence:

    • Slc25a26 knockout in MC38 mouse colon cancer cells resulted in massive cell death

    • The copper complex CTB has been shown to inhibit tumorigenesis in vivo by upregulating Slc25a26 expression

  • Potential Therapeutic Implications:

    • Both extreme high and low levels of Slc25a26 expression can inhibit or kill cancer cells via distinct pathways

    • This suggests that either Slc25a26 inhibitors or activators might represent novel cancer therapeutic approaches, depending on the cancer type and context

These findings indicate that precisely controlled Slc25a26 expression is critical for cancer cell survival, and perturbation in either direction could potentially be exploited therapeutically.

How does Slc25a26 expression affect oocyte quality and embryonic development in mice?

Research has demonstrated that Slc25a26 plays a crucial role in determining oocyte quality and subsequent embryonic development in mice:

  • Effects on Oocyte Quality:

    • Excessive SLC25A26 accumulation in mouse oocytes mimics naturally aged oocytes

    • Overexpression results in decreased oocyte maturation rates

    • Increased reactive oxygen species (ROS) production due to impaired mitochondrial function

  • Molecular Mechanisms:

    • Altered expression of mitochondrial genes, particularly mt-Cytb, which regulates the mitochondrial respiratory chain

    • Disrupted methylation patterns within mitochondria

    • Compromised mitochondrial energy production necessary for oocyte maturation

  • Impact on Early Embryonic Development:

    • Increased levels of Slc25a26 in fertilized oocytes compromise blastocyst formation

    • Complete knockout of Slc25a26 is embryonically lethal, highlighting its essential role in development

  • Dose-Dependency:

    • Studies indicate that proper levels of Slc25a26 are critical—both overexpression and knockout produce detrimental effects

    • This suggests a tight regulatory window for optimal mitochondrial function during oogenesis and early development

These findings highlight Slc25a26 as a potential biomarker for oocyte quality and embryonic developmental potential in reproductive biology research. They also suggest that modulating Slc25a26 expression or activity might be relevant for addressing age-related decline in female fertility, though such applications require extensive further research.

What are the molecular mechanisms by which Slc25a26 influences mitochondrial methylation and gene expression?

The molecular mechanisms through which Slc25a26 influences mitochondrial methylation and gene expression involve a complex interplay between substrate availability, methyltransferase activity, and downstream effects:

  • Regulation of Substrate Availability:

    • As the exclusive transporter of SAM into mitochondria, Slc25a26 directly controls the availability of methyl groups for all mitochondrial methylation reactions

    • Simultaneously, by exporting SAH (a potent inhibitor of methyltransferases), it prevents product inhibition of methylation reactions

  • Targets of Mitochondrial Methylation:

    • Mitochondrial DNA (mtDNA): Methylation patterns affect transcription and replication

    • Mitochondrial RNA: Modifications influence stability, processing, and translation efficiency

    • Mitochondrial Proteins: Post-translational methylation affects function, interactions, and stability

  • Impact on Mitochondrial Gene Expression:

    • Studies show that Slc25a26 expression levels impact mitochondrial genes such as mt-Cytb, which regulates the mitochondrial respiratory chain

    • Disruption of Slc25a26 impairs mitochondrial RNA stability and protein synthesis

  • Feedforward and Feedback Loops:

    • Changes in mitochondrial methylation can affect the expression of nuclear-encoded mitochondrial genes through retrograde signaling

    • This creates complex regulatory circuits where altered Slc25a26 function can have amplified effects on cellular metabolism

  • Integration with Cellular Metabolic Pathways:

    • By influencing SAM/SAH balance, Slc25a26 connects mitochondrial function to cytosolic one-carbon metabolism

    • This links mitochondrial methylation to broader cellular processes including redox balance, nucleotide synthesis, and amino acid metabolism

Research models with altered Slc25a26 expression demonstrate these mechanisms through changes in mitochondrial DNA methylation patterns, RNA modifications, and subsequent disruptions in respiratory chain complexes and energy production.

How do post-translational modifications regulate Slc25a26 transport activity?

Post-translational modifications (PTMs) of Slc25a26 represent an important but understudied aspect of its regulation. Current research suggests several mechanisms:

  • Phosphorylation:

    • Potential phosphorylation sites exist within the protein structure, particularly in matrix-facing loops

    • Phosphorylation likely modulates transport activity by altering substrate binding affinity or transport kinetics

    • Kinases including PKA and CaMKII may be involved in this regulation

  • Acetylation:

    • Mitochondrial proteins are subject to acetylation, which can be regulated by sirtuins

    • Acetylation status may influence Slc25a26 stability and activity, particularly in response to metabolic changes

    • Deacetylation by SIRT3 could potentially activate the transporter in conditions of energy stress

  • Redox Modifications:

    • Conserved cysteine residues may undergo oxidation, nitrosylation, or glutathionylation

    • These modifications could serve as sensors linking transport activity to mitochondrial redox state

    • During oxidative stress, such modifications might reduce transport activity as a protective mechanism

  • Ubiquitination and Protein Turnover:

    • Regulation of Slc25a26 abundance through the ubiquitin-proteasome system

    • Specific E3 ligases may target Slc25a26 for degradation under certain conditions

    • Half-life regulation represents an additional control point for long-term adaptation

These regulatory mechanisms likely integrate signals from various cellular pathways to fine-tune mitochondrial methylation capacity according to physiological demands. Methodological approaches to study these modifications include mass spectrometry-based proteomics, site-directed mutagenesis of potential modification sites, and in vitro transport assays with purified protein subjected to specific enzymatic modifications.

How does mouse Slc25a26 compare to its homologs in other model organisms?

Mouse Slc25a26 shares significant homology with its counterparts across various species, reflecting the evolutionary conservation of this crucial mitochondrial transport function:

SpeciesHomolog NameSequence Identity with MouseKey Functional Characteristics
HumanSLC25A26~95%Similar transport kinetics and tissue distribution
RatSlc25a26~98%Nearly identical functional properties
Zebrafishslc25a26~80%Conserved transport function, developmental importance
Fruit FlyNot named~45%Used in models demonstrating SAH transport significance
YeastSAM5~30%First identified SAM transporter, functional complementation possible

This evolutionary conservation underscores the fundamental importance of SAM/SAH transport across eukaryotic lineages. While the core transport function remains conserved, species-specific differences may exist in regulatory mechanisms, tissue distribution patterns, and interactions with other cellular components.

Studies using fruit fly models have been particularly valuable in demonstrating that impairment of SAH transport (rather than SAM transport) across the mitochondrial membrane is likely the cause of milder, late-onset phenotypes in mitochondrial disease . Meanwhile, yeast SAM5 has been critical for understanding the basic mechanisms of this transport system, with functional complementation studies providing insights into structure-function relationships .

These comparative studies highlight the value of diverse model organisms in understanding the fundamental biology of Slc25a26 and its role in cellular metabolism across species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.