Recombinant Mouse SAYSvFN domain-containing protein 1 (Saysd1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
Saysd1; SAYSvFN domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Saysd1
Target Protein Sequence
MEQRLAEFREARKRASLVAQPSTSSQSVQTSGAKAEPAAATPKTATGWLTRFLKRKANPA IAQAQPNQPQEAGQQLPESTAVPLPSSCRQSFLTNITFLKVLLWLVLLGLFVELEFGLAY FVLSMFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLEQELQLRPPQGSRT SPSCSSYP
Uniprot No.

Target Background

Database Links

KEGG: mmu:67509

UniGene: Mm.292423

Subcellular Location
Cytoplasmic vesicle membrane; Single-pass membrane protein.

Q&A

FAQs for Recombinant Mouse SAYSvFN Domain-Containing Protein 1 (SAYSD1)

What is the molecular function of SAYSD1 in translocation-associated quality control (TAQC)?

SAYSD1 acts as a sensor for UFMylated ribosomes at clogged endoplasmic reticulum (ER) translocons, facilitating the degradation of stalled nascent proteins via lysosomal pathways . Key methodological insights:

  • Mechanism: SAYSD1 binds Sec61 translocon and recognizes UFM1-modified ribosomes, recruiting the TRAPP complex to direct stalled substrates to lysosomes .

  • Validation: Use co-immunoprecipitation (Co-IP) with Sec61β and ribosome profiling under translation-stalling conditions (e.g., anisomycin treatment) .

How to confirm SAYSD1 expression and subcellular localization in murine tissues?

  • Expression profiling: Perform RNA in situ hybridization or immunohistochemistry on testis sections, focusing on round/elongating spermatids .

  • Localization: Combine ER-specific markers (e.g., calnexin) with immunofluorescence in spermatids. Sucrose gradient centrifugation confirms SAYSD1 co-sedimentation with ER membranes .

What are standard methods to produce recombinant mouse SAYSD1 for in vitro studies?

  • Expression systems: Use HEK293 or insect cell lines with codon-optimized constructs for full-length SAYSD1 (including the conserved SAYSvFN domain and transmembrane region) .

  • Functional validation: Test recombinant SAYSD1’s ability to bind UFMylated ribosomes via pull-down assays using purified ribosomes and UFM1 conjugation systems .

How to resolve contradictions in SAYSD1’s role in ER stress regulation?

Studies report conflicting data: SAYSD1 knockout mice show no ER stress marker elevation , while siRNA depletion in cell models triggers ER stress .

  • Experimental design adjustments:

    FactorKnockout Mice Cell Models
    SystemWhole organismCultured cells
    CompensationRedundant pathwaysAcute depletion
    Stress inductionBaseline conditionsTranslation stalling (ANS)
  • Recommendations: Induce ER stress chemically (tunicamycin) in knockout mice or use tissue-specific conditional knockouts to assess compensatory mechanisms .

Optimal strategies for CRISPR/Cas9-mediated SAYSD1 knockout in fertility studies

  • Guide design: Use validated sgRNAs targeting exons encoding the SAYSvFN domain (e.g., Broad Institute’s designs) .

  • Phenotyping: Beyond fertility metrics, quantify epididymal sperm counts and motility. Despite normal fertility in knockouts, subtle defects in sperm production occur .

  • Controls: Include UFM1 knockout models to dissect SAYSD1-dependent vs. independent TAQC pathways .

How to assay SAYSD1’s interaction with UFMylated ribosomes?

  • Co-IP under stalling conditions: Treat cells with anisomycin, immunoprecipitate SAYSD1, and probe for UFM1 and ribosomal proteins (e.g., RPL26) .

  • Sucrose gradient analysis: Resolve SAYSD1-ribosome complexes under ER stress and confirm via immunoblotting .

  • Mutagenesis: Test SAYSD1 mutants (e.g., ΔN17, SAYSvFN motif alanine substitutions) for ribosome-binding defects .

Interpreting tissue-specific roles of SAYSD1 in spermatogenesis vs. systemic ER homeostasis

  • Spermatogenesis: SAYSD1 is dispensable for fertility but influences sperm production efficiency (reduced cauda epididymis sperm counts) .

  • ER homeostasis: SAYSD1 is critical in collagen-secreting cells (e.g., Drosophila fat body), where its loss causes basement membrane defects .

  • Methodological approach: Use tissue-specific knockouts (e.g., germ cell vs. hepatocyte Cre lines) to isolate context-dependent functions .

Data Contradiction Analysis

Conflict: SAYSD1’s role in ER stress is unclear in vivo vs. in vitro.

  • Hypothesis: Redundant quality control pathways may compensate in whole organisms.

  • Testing: Perform dual knockout of SAYSD1 and UFM1 in mice to unmask synthetic phenotypes .

Key citation: SAYSD1 depletion stabilizes ER GFP_K20 (a TAQC substrate) by 2.5-fold in siRNA-treated cells , but no ER stress is observed in knockout mice .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.