Recombinant Mouse Secretory carrier-associated membrane protein 1 (Scamp1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
Scamp1; Secretory carrier-associated membrane protein 1; Secretory carrier membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-338
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Scamp1
Target Protein Sequence
MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGSVKMPNVPNTQ PAIMKPTEEHPAYTQITKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNW PPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSR AVDFGLSILWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFH NWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQ QEFATGVMSNKTVQTAAANAASTAATSAAQNAFKGNQM
Uniprot No.

Target Background

Function
Secretory carrier-associated membrane protein 1 (Scamp1) functions in post-Golgi recycling pathways. It acts as a recycling carrier to the cell surface.
Database Links
Protein Families
SCAMP family
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein. Recycling endosome membrane; Multi-pass membrane protein.

Q&A

What is Secretory Carrier-Associated Membrane Protein 1 (SCAMP1) and what is its function?

SCAMP1 is a member of the SCAMP family of tetraspanning integral membrane proteins that are evolutionarily conserved from insects to mammals and plants. Mammalian genomes contain five SCAMP genes (SCAMP1-SCAMP5) . SCAMP1 is the most universally expressed member of the SCAMP family .

Functionally, SCAMP1 regulates membrane dynamics, particularly membrane-depolarization and calcium-dependent exocytosis. It serves as a carrier to the cell surface in post-Golgi recycling pathways . Key functions include:

  • Regulation of fusion pore formation and closure during exocytosis

  • Facilitation of endocytosis

  • Regulation of vesicular trafficking

  • Involvement in post-Golgi recycling pathways

  • Modulation of neurotransmitter release in neurons

The protein contains four transmembrane spans with a conserved membrane core and amphiphilic segments that likely reside in the cytoplasm-facing membrane interface .

How is SCAMP1 structurally organized and what domains contribute to its function?

SCAMP1 structure includes:

  • Four transmembrane spans forming a ∼20-kDa membrane core

  • Three conserved amphiphilic segments that bind to phospholipid membranes

  • The central amphiphilic segment linking transmembrane spans 2 and 3 adopts an α-helical structure

  • N-terminal and C-terminal cytoplasmic domains

Studies using limited proteolysis and Western blotting with isolated secretory granules have shown that SCAMP1 is degraded sequentially from the N terminus and then the C terminus, yielding the membrane core with four transmembrane spans . Topology mapping through expression of alkaline phosphatase gene fusions in E. coli has further confirmed this structural organization .

The amphiphilic segments play a particularly important role, as they have been demonstrated to bind to phospholipid membranes, with the central segment adopting an α-helical conformation that likely contributes to membrane interactions .

What phenotypes are associated with SCAMP1 deficiency in model organisms?

SCAMP deficiency leads to varied behavioral abnormalities in model organisms, particularly in Drosophila mutants. These phenotypes include:

  • Altered mobility and climbing ability

  • Reduced lifespan

  • Impaired odor-associated learning

  • Deficits in long-term memory

  • Abnormal neuronal functions in vivo

These findings indicate the importance of membrane dynamics mediated by SCAMP proteins in neuronal functions in vivo . The behavioral abnormalities observed in SCAMP-deficient Drosophila represent the first evidence that genetic depletion of SCAMP at the organismal level leads to functionally significant consequences .

How does SCAMP1 regulate fusion pore dynamics during exocytosis in neuroendocrine cells?

SCAMP1 plays a dual role in regulating fusion pore dynamics during exocytosis in neuroendocrine cells:

  • Fusion pore dilation: SCAMP1 facilitates the dilation of newly opened fusion pores during the onset of dense core vesicle (DCV) exocytosis.

  • Fusion pore closure: SCAMP1 promotes the closure of fusion pores after they have opened. Reduced SCAMP1 expression inhibits closure of fusion pores, causing accumulation of fusion figures at the plasma membrane .

In PC12 neuroendocrine cells, SCAMP1 knockdown delays fusion pore closure, while overexpression slightly accelerates closure. This suggests that SCAMP1 functions in exo-endocytic coupling and in the regulation of partial secretion .

What molecular interactions mediate SCAMP1's role in membrane trafficking?

SCAMP1 interacts with several key proteins to mediate its role in membrane trafficking:

  • Neurotransmitter transporters (SLC6 family): SCAMPs bind to these transporters and regulate their cell-surface targeting .

  • Na+/H+ exchanger NHE5: SCAMP1 interacts with this neuron-enriched pH regulator, which is predominantly associated with endocytic recycling organelles in resting cells. SCAMPs play a role in targeting NHE5 from endosomes to the plasma membrane .

  • SNARE proteins: SCAMPs interact with components of the SNARE complex that mediate membrane fusion during exocytosis.

  • Dynamin: SCAMP1 may coordinate with dynamin, which is involved in the completion of endocytosis.

These interactions collectively enable SCAMP1 to regulate vesicle fusion, membrane recycling, and the coupling between exocytosis and endocytosis in a coordinated manner.

How is SCAMP1 expression dysregulated in pathological conditions and what are the implications?

SCAMP1 expression is altered in several pathological conditions:

  • Cancer: SCAMP1 expression is significantly increased in most cancer types, including gastric cancer where it is aberrantly upregulated and positively correlated with tumor size and lymph node metastasis .

  • Neuropsychiatric disorders: DNA microarray analysis has identified decreased SCAMP1 expression in the prefrontal cortex of schizophrenia patients, which may be associated with symptomatic activity of this disease .

  • Developmental disorders: SCAMP5, another member of the SCAMP family, has been identified as a candidate for autism susceptibility gene .

In gastric cancer specifically, increased SCAMP1 expression is associated with poor prognosis. Functional experiments have demonstrated that SCAMP1 knockdown markedly suppresses the proliferation of gastric cancer cells .

These findings suggest that SCAMP1 may serve as a potential diagnostic marker or therapeutic target in certain cancers and neuropsychiatric disorders.

What are the optimal methods for generating and purifying recombinant mouse SCAMP1 protein?

The optimal methodology for generating and purifying recombinant mouse SCAMP1 involves:

  • Cloning strategy:

    • PCR amplification of mouse SCAMP1 cDNA with appropriate restriction sites

    • Subcloning into a suitable expression vector (bacterial, insect, or mammalian)

    • For bacterial expression, considerations must be made for the transmembrane nature of SCAMP1

    • Fusion tags (His, GST, MBP) should be incorporated for purification purposes

  • Expression systems:

    • Bacterial systems (E. coli): Suitable for cytoplasmic domains but challenging for full-length protein due to transmembrane segments

    • Insect cell systems (Sf9, Hi5): Preferred for full-length membrane proteins

    • Mammalian expression systems: Optimal for preserving post-translational modifications

  • Purification protocol:

    • Membrane fraction isolation using differential centrifugation

    • Solubilization with appropriate detergents (e.g., CHAPS, DDM, or Triton X-100)

    • Affinity chromatography using tag-based purification

    • Size exclusion chromatography for further purification

    • Quality control by SDS-PAGE and Western blotting with specific antibodies

Based on previous studies, antibodies against specific peptide sequences such as 1α (SDFDSNPFADPDLNN-NorLeu(C)), 1ς (KKVHGLYRTTGASFEK), and 1ω ((C)TSAAQNAFKGNQM) have been used successfully for detection and characterization of SCAMP1 .

What are the recommended approaches for studying SCAMP1 function through genetic manipulation?

Several approaches have been validated for studying SCAMP1 function through genetic manipulation:

  • RNA interference (RNAi):

    • shRNA-mediated knockdown using lentiviral vectors

    • Validated target sequences include 5'-CCAAACCTGTAGTTACAGAAA-3' (shS1#1) and 5'-CCTCAGTCAACATGGTAGAAA-3' (shS1#2)

    • Selection of stable cell populations using puromycin (2 μg/ml)

    • Verification of knockdown efficiency by qRT-PCR and Western blotting

  • CRISPR-Cas9 gene editing:

    • Design of guide RNAs targeting conserved exons of SCAMP1

    • Verification of editing by sequencing and functional assays

    • Generation of cell lines with complete SCAMP1 knockout

  • Transgenic models:

    • Generation of SCAMP-deficient Drosophila through P-element mobilization

    • Creation of conditional knockout mice using Cre-loxP system

    • Rescue experiments through expression of wild-type or mutant SCAMP1

  • Expression of dominant-negative variants:

    • Generation of truncated forms lacking functional domains

    • Expression of mutated forms with altered regulatory sites

For analysis of gene expression, qRT-PCR primers such as forward: 5'-GAAACCAACAGAGGAACATCCAG-3' and reverse: 5'-CCGACGATCTAATTCTGCGGCT-3' have been successfully used, with GAPDH as an internal control .

What cellular assays are most informative for evaluating SCAMP1 function in membrane trafficking?

Several specialized assays have proven valuable for evaluating SCAMP1 function in membrane trafficking:

  • Fusion pore dynamics assays:

    • Real-time microscopy to track opening and closure of fusion pores

    • FM dye-based assays to monitor exo-endocytic coupling

    • Amperometry to measure kinetics of neurotransmitter release

  • Membrane trafficking assays:

    • Transferrin recycling assays to measure endocytic trafficking

    • Biotinylation assays to quantify surface protein expression

    • Fluorescent protein-tagged cargo trafficking using time-lapse imaging

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Proximity ligation assays to detect in situ interactions

    • FRET/BRET assays to measure dynamic interactions

  • Functional cellular assays:

    • Cell proliferation using CCK-8 and EdU incorporation assays

    • In vivo tumor growth assays using nude mice models

    • Neuronal activity assays including calcium imaging

An RNA sequencing approach has also been informative for identifying differentially expressed genes following SCAMP1 knockdown, with subsequent GO and KEGG pathway enrichment analysis to identify affected pathways .

How can researchers differentiate between direct and indirect effects of SCAMP1 manipulation in experimental systems?

Differentiating between direct and indirect effects of SCAMP1 manipulation requires a multi-faceted approach:

  • Temporal analysis:

    • Track changes immediately following acute SCAMP1 manipulation (likely direct)

    • Compare with changes observed after prolonged manipulation (may include indirect)

    • Use inducible systems to provide temporal control over SCAMP1 expression

  • Rescue experiments:

    • Reintroduce wild-type SCAMP1 to see if phenotypes are reversed

    • Test domain-specific mutants to identify critical functional regions

    • Use structurally related but functionally distinct proteins as controls

  • Interaction studies:

    • Identify direct binding partners through protein-protein interaction studies

    • Determine if effects are mediated through these binding partners

    • Disrupt specific interactions to determine if phenotypes persist

  • Pathway analysis:

    • RNA sequencing to identify differentially expressed genes

    • Pathway enrichment analysis to identify affected cellular processes

    • Validation of key pathway components through independent manipulation

In published studies, RNA sequencing has been used to identify differentially expressed genes (DEGs) following SCAMP1 knockdown, with genes showing |log2FC| > 1 and P < 0.05 classified as DEGs . This approach, combined with GO and KEGG pathway analysis, can provide insights into the broader cellular processes affected by SCAMP1 manipulation.

What statistical approaches are recommended for analyzing SCAMP1-related experimental data?

Based on published SCAMP1 research, the following statistical approaches are recommended:

Statistical significance is typically denoted as follows: * (P < 0.05), ** (P < 0.01), *** (P < 0.001), and **** (P < 0.0001) .

GraphPad Prism (version 8.0) has been successfully used to calculate significant differences and generate charts in SCAMP1 research .

How should researchers address contradictory findings regarding SCAMP1 function across different cell types?

Addressing contradictory findings regarding SCAMP1 function requires a systematic approach:

  • Cell type-specific context:

    • Compare expression levels of SCAMP1 and other SCAMP family members across cell types

    • Assess expression of known SCAMP1 interacting partners

    • Consider differences in membrane composition and trafficking machinery

  • Methodological considerations:

    • Evaluate differences in experimental approaches (knockdown vs. knockout)

    • Consider the degree of SCAMP1 depletion achieved

    • Assess potential compensatory mechanisms by other SCAMP family members

  • Integration of findings:

    • Construct cell type-specific models of SCAMP1 function

    • Identify core functions preserved across cell types

    • Highlight context-dependent specialized functions

  • Experimental validation:

    • Perform parallel experiments in multiple cell types under identical conditions

    • Use rescue experiments with cell type-specific SCAMP1 variants

    • Investigate the role of post-translational modifications in cell type-specific functions

The literature suggests that while SCAMP1 has a universal role in membrane trafficking, its specific effects on processes like fusion pore dynamics in neuroendocrine cells versus cell proliferation in cancer cells may reflect cell type-specific adaptations of its core function.

How can recombinant SCAMP1 be utilized in screening platforms for neuropsychiatric drug discovery?

Recombinant SCAMP1 can be strategically employed in neuropsychiatric drug discovery through multiple approaches:

  • High-throughput binding assays:

    • Develop fluorescence-based or FRET assays using purified recombinant SCAMP1

    • Screen compound libraries for molecules that modulate SCAMP1 interactions with partners

    • Focus on interactions relevant to neuropsychiatric disorders (e.g., neurotransmitter transporters)

  • Functional cellular assays:

    • Generate reporter cell lines expressing SCAMP1 fused to fluorescent proteins

    • Monitor membrane trafficking in response to compound treatment

    • Assess effects on neurotransmitter release and recycling

  • Reconstituted systems:

    • Create proteoliposomes containing recombinant SCAMP1 and interacting partners

    • Measure fusion and trafficking events in response to candidate compounds

    • Develop label-free detection methods for screening applications

  • Disease-relevant assays:

    • Based on findings linking decreased SCAMP1 expression to schizophrenia

    • Screen for compounds that normalize SCAMP1 expression or function

    • Validate hits in neurons derived from patient iPSCs

The connection between SCAMP1 and neurotransmitter transporters (solute carrier 6, SLC6), which play significant roles in emotion and social behavior , provides a particularly promising avenue for neuropsychiatric drug discovery.

What are the implications of SCAMP1 in cancer biology and potential therapeutic strategies?

Research indicates significant implications of SCAMP1 in cancer biology:

  • Expression and prognostic significance:

    • SCAMP1 is aberrantly increased in most cancer types

    • In gastric cancer, increased expression positively correlates with tumor size and lymph node metastasis

    • High SCAMP1 expression is associated with poor prognosis

  • Functional role in cancer progression:

    • SCAMP1 knockdown markedly suppresses cancer cell proliferation

    • Experimental evidence from both in vitro (CCK-8 and EdU incorporation assays) and in vivo (nude mice xenograft models) demonstrates anti-proliferative effects of SCAMP1 silencing

  • Molecular mechanisms:

    • RNA sequencing of SCAMP1-silenced cells reveals alterations in multiple pro-oncogenic pathways

    • SCAMP1 may regulate cell surface expression of growth factor receptors or adhesion molecules

  • Therapeutic strategies:

    • Direct targeting of SCAMP1 expression (e.g., siRNA, antisense oligonucleotides)

    • Disruption of specific SCAMP1 interactions important for cancer progression

    • Development of small molecules that modulate SCAMP1 function in membrane trafficking

The ability to establish stable cell populations with reduced SCAMP1 expression using lentiviral shRNA vectors, as demonstrated in research , provides a valuable platform for both mechanistic studies and therapeutic development.

What emerging technologies could advance our understanding of SCAMP1 dynamics in live cells?

Several cutting-edge technologies hold promise for advancing our understanding of SCAMP1 dynamics:

  • Super-resolution microscopy techniques:

    • STORM/PALM imaging to visualize SCAMP1 distribution at nanoscale resolution

    • Live-cell super-resolution to track SCAMP1 dynamics during exo-endocytosis

    • Correlative light and electron microscopy to connect SCAMP1 localization with membrane ultrastructure

  • Advanced protein engineering approaches:

    • Split fluorescent protein systems to visualize SCAMP1 interactions in real-time

    • Optogenetic tools to spatiotemporally control SCAMP1 function

    • CRISPR-based imaging to visualize endogenous SCAMP1 in living cells

  • Single-molecule techniques:

    • Single-molecule tracking to follow individual SCAMP1 molecules during trafficking

    • Single-molecule FRET to detect conformational changes during function

    • Optical tweezers to measure forces associated with SCAMP1-mediated membrane events

  • Cryo-electron microscopy:

    • Structural determination of SCAMP1 in different functional states

    • Visualization of SCAMP1 in context of native membrane environments

    • Mapping of interaction interfaces with binding partners

These technologies would significantly enhance our understanding of the dynamic behavior of SCAMP1 during vesicular trafficking and membrane fusion events beyond what has been possible with conventional light microscopy approaches used in previous studies .

How might comparative studies across SCAMP family members inform selective targeting strategies?

Comparative studies across the SCAMP family (SCAMP1-5) could inform selective targeting through several approaches:

  • Structural comparison:

    • Identification of unique structural features among SCAMP family members

    • Mapping of conserved versus divergent interaction surfaces

    • Determination of isoform-specific post-translational modification sites

  • Functional differentiation:

    • Comparative knockout/knockdown studies of different SCAMPs

    • Analysis of compensatory mechanisms among family members

    • Identification of unique versus redundant cellular functions

  • Expression pattern analysis:

    • Comprehensive tissue-specific expression profiling of all SCAMP family members

    • Correlation of expression patterns with physiological functions

    • Identification of contexts where specific SCAMPs predominate

  • Selective targeting approaches:

    • Development of isoform-specific antibodies or nanobodies

    • Design of peptides that disrupt specific SCAMP interactions

    • Small molecule screening against unique binding pockets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.