Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 10 (Skint10)

Shipped with Ice Packs
In Stock

Description

Overview of Skint10

Skint10, or Selection and upkeep of intraepithelial T cells 10, is one of the Skint paralogs found in mice . The Skint gene family, which includes Skint1 through Skint11 in mice, encodes structurally related proteins with similar expression patterns and distinct functions . Skint10 is predicted to enable signaling receptor binding activity, and participate in the T cell receptor signaling pathway and regulation of cytokine production .

Skint10 and the Skint Gene Family

The Skint gene family plays a crucial role in the immune system, particularly in the development and function of specialized T cells.

Key characteristics of the Skint gene family:

  • Paralogs: Mice possess 11 Skint genes (Skint1 to Skint11), which code for structurally related proteins .

  • Functional Specialization: Each paralog has a distinct function. Skint1 is essential for the selection of Vγ5Vδ1 T cells, while other Skint proteins like Skint3 and Skint9 are involved in mediating dendritic epidermal T cells (DETC) activation in the epidermis .

  • Expression: Skint paralogs are expressed in the thymus and/or skin, and some are expressed in other tissues .

  • Evolution: Skint paralogs show rapid evolution .

Functional Aspects of Skint10

Skint10 is predicted to have the following functions :

  • Signaling receptor binding activity

  • Involvement in the T cell receptor signaling pathway

  • Regulation of cytokine production

Skint1 and its Role as a Prototype

Skint1 is the prototype of the Skint family and is vital for the development of intraepithelial T cells .

Key features of Skint1:

  • Encodes a protein with immunoglobulin-like and transmembrane domains .

  • Expressed in the thymus and skin .

  • May engage a cell surface molecule on immature Vγ5+Vδ1+ T cells in the embryonic thymus .

Relevance to Human Studies

While Skint10 is specific to mice, studies involving humanized mouse models provide insights into T cell function and immune responses.

Humanized mouse models:

  • Allow the study of human memory T cells in a tissue environment, crucial since the tissue environment impacts the phenotype and function of memory T cells .

  • Can be used to evaluate invariant Natural Killer T cell responses .

  • Useful for assessing iNKT cell-directed strategies for downstream translational work .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
Skint10; Selection and upkeep of intraepithelial T-cells protein 10; Skint-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-330
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Skint10
Target Protein Sequence
LDIQINIQVPDTEGVLLECTSGSLIPPAEMTWRDSKGNIIPHSTTFDSQDRAGLLYLKSS ILLKNRVQSPITCSIYNVTTNREKKRSVVLPDILFKSEYMSLMSNKFSCPLTYLFIIIFL NCLKGMLDFCCLKGKPVYFRELINKIKEVLNIKMRACCTLIWEFLLIVLYIAFLPFYLKF RSRASILDDAYPLHSNWLWDICIVLSVLMIFFTGLSLFLLWTLNCYGQMSYLPSMSMDLS KHDFEQNSSKSSEFQENYDVSCEIFLGTFEETIFSQHQESCIEDSFNPLQPLRLDCSLNW KT
Uniprot No.

Target Background

Function

May act by interacting with a cell surface molecule on immature T-cells within the embryonic thymus.

Database Links

KEGG: mmu:230613

UniGene: Mm.122553

Protein Families
SKINT family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in skin and thymus.

Q&A

What is Skint10 and how does it relate to epithelial immune function?

Skint10 (Selection and upkeep of intraepithelial T-cells protein 10) is a member of the butyrophilin-like (BTNL) protein family that plays a role in intraepithelial T cell development and function. As demonstrated through studies of related family members like Skint1, these proteins mediate interactions between epithelial cells and resident T cells, particularly γδ T cells . Skint10 is expressed as a 330 amino acid protein with characteristic immunoglobulin-like domains that facilitate protein-protein interactions with T cell receptors . While Skint1 has been extensively characterized for its role in selecting and maintaining Vγ5Vδ1+ dendritic epidermal T cells, Skint10's specific immunological function appears to involve similar "normality sensing" mechanisms that help maintain tissue homeostasis and barrier function through interactions with intraepithelial lymphocytes .

How is Skint10 expressed and localized in murine tissues?

Skint10 expression patterns follow similar distributions to other Skint family members, with primary expression in epithelial tissues, particularly the epidermis. Studies of related family members indicate that expression increases with keratinocyte differentiation, suggesting a developmental regulation of Skint10 . The protein localizes primarily to the cell membrane of differentiated keratinocytes, positioning it to interact with intraepithelial T lymphocytes that reside in the epithelial layer . While Skint1 has been specifically shown to determine the development of Vγ5Vδ1+ dendritic epidermal T cells, Skint10 likely plays a role in selecting and maintaining specific subpopulations of intraepithelial T cells through similar mechanisms .

What are the optimal conditions for reconstitution and storage of recombinant Skint10?

For optimal reconstitution of lyophilized recombinant Skint10:

  • Centrifuge the vial briefly before opening to ensure all material is at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% (or between 5-50%) to stabilize the protein

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles

Storage recommendations:

  • Store lyophilized powder at -20°C/-80°C upon receipt

  • Store reconstituted working aliquots at 4°C for up to one week

  • For long-term storage, keep aliquoted material at -20°C/-80°C

  • Avoid repeated freeze-thaw cycles as this significantly reduces protein activity

The protein is stable in Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain proper folding and biological activity .

How can researchers validate the functional activity of recombinant Skint10?

Functional validation of recombinant Skint10 requires multiple complementary approaches:

  • Biochemical validation:

    • SDS-PAGE analysis to confirm >90% purity

    • Western blotting with anti-His tag antibodies to verify expression

    • Mass spectrometry to confirm sequence identity

  • Structural integrity assessment:

    • Circular dichroism to evaluate secondary structure

    • Size exclusion chromatography to confirm monomeric state

  • Functional validation:

    • T cell binding assays using flow cytometry

    • Co-immunoprecipitation with potential γδ TCR partners

    • Measurement of downstream signaling events in responsive T cells

  • Comparative analysis:

    • Side-by-side comparison with Skint1 in DETC development assays

    • Competition assays with other Skint family members

Researchers should establish positive controls using well-characterized Skint family members like Skint1, which has known effects on γδ T cell development and function .

What experimental models are most appropriate for studying Skint10 function?

Several experimental models are suitable for investigating Skint10 function:

  • In vitro models:

    • Primary keratinocyte cultures from mouse epidermis

    • Co-culture systems with γδ T cells and Skint10-expressing cells

    • Reconstituted epidermal equivalents with defined T cell populations

  • Ex vivo models:

    • Epidermal sheets for studying resident T cell-keratinocyte interactions

    • Organ culture of skin explants

  • In vivo models:

    • Transgenic mice with Skint10 overexpression

    • Conditional knockout models (similar to studies with Skint1)

    • Bone marrow chimeras to distinguish T cell intrinsic vs. extrinsic effects

  • Challenge models:

    • UVB radiation exposure to assess barrier protection functions

    • Wound healing studies to evaluate tissue repair mechanisms

    • Chemical sensitization to investigate inflammatory responses

Based on findings with Skint1, researchers should consider the impact of Skint10 on both steady-state tissue homeostasis and responses to environmental challenges like UVB radiation, which has been shown to induce DNA damage and inflammation in models with disrupted "normality sensing" .

How can Skint10 be used to investigate epithelial-lymphocyte interactions?

Recombinant Skint10 provides a valuable tool for investigating epithelial-lymphocyte interactions through multiple experimental approaches:

  • Reconstitution experiments:

    • Add purified Skint10 to epithelial cell cultures lacking endogenous expression

    • Monitor changes in IEL phenotype, positioning, and function

    • Assess barrier integrity in reconstituted systems

  • Competition assays:

    • Use soluble Skint10 to disrupt endogenous Skint-TCR interactions

    • Measure displacement of resident T cells from epithelial layers

    • Quantify changes in macromolecular TCR aggregates

  • Signaling studies:

    • Determine pathways activated in both epithelial cells and T cells

    • Map the bidirectional communication systems

    • Identify differences between steady-state and stress-induced signaling

  • Live imaging:

    • Fluorescently label Skint10 to visualize interactions with TCRs

    • Track formation and dissolution of Skint10-TCR clusters

    • Monitor T cell migration and positioning relative to Skint10-expressing cells

These approaches can reveal how Skint10, like other family members, may participate in the "normality sensing" mechanism described for Skint1, where TCR interactions with Skint proteins license tissue-resident T cells to respond to subsequent perturbations using innate-like mechanisms .

What methodological considerations are important for isolating Skint10-responsive T cells?

Isolating Skint10-responsive T cells requires careful attention to methodological details:

  • Tissue processing:

    • Use gentle enzymatic digestion to preserve TCR surface expression

    • Optimize temperature and incubation times to maintain cell viability

    • Consider mechanical separation techniques for epithelial tissues

  • Selection strategies:

    • Flow cytometry-based sorting using specific γδ TCR markers

    • Enrichment through Skint10-coated magnetic beads

    • Selective expansion of responsive populations

  • Validation approaches:

    • Functional assays measuring cytokine production upon Skint10 exposure

    • Ca2+ flux assays to confirm TCR engagement

    • Microscopy to visualize TCR clustering in response to Skint10

  • Single-cell analysis:

    • Transcriptomic profiling to identify Skint10-responsive subpopulations

    • TCR sequencing to determine repertoire bias

    • Spatial transcriptomics to map responsive cells within intact tissue

Based on studies with related proteins, researchers should consider that Skint10-responsive T cells may represent specific subsets with unique TCR configurations and effector functions that contribute to tissue homeostasis through "normality sensing" mechanisms .

How does Skint10 function compare to other Skint family members?

Skint10 shares structural and functional similarities with other Skint family members, but exhibits distinct properties:

FeatureSkint1Skint10Other Skint Family Members
Primary T cell targetsVγ5Vδ1+ dendritic epidermal T cellsSpecific intraepithelial T cell subsets (less characterized)Various tissue-specific γδ T cell populations
Expression patternDifferentiated keratinocytesDifferentiated keratinocytesTissue-specific epithelial cells
Role in developmentEssential for thymic selection of DETCsLikely involved in selection of specific IEL subsetsVariable roles in IEL development
Barrier functionCritical for epidermal barrier integrityPresumed role in epithelial barrier maintenanceTissue-specific barrier support
"Normality sensing"Mediates steady-state TCR aggregationLikely participates in similar mechanismsFamily-wide function in tissue surveillance
Response to stressLicenses rapid IEL responses to UVBPotential role in environmental challenge responsesContext-dependent stress responses

While Skint1 has been extensively characterized for its essential role in the development and function of Vγ5Vδ1+ dendritic epidermal T cells, Skint10 likely performs analogous functions for different T cell subsets, contributing to the diverse "normality sensing" mechanisms that maintain tissue homeostasis across different epithelial compartments .

What is known about the evolutionary conservation of Skint10 across species?

Skint proteins, including Skint10, show interesting evolutionary patterns that provide insights into their specialized functions:

  • Mouse-specific expansion:

    • The Skint gene family has undergone significant expansion in mice

    • Skint10 represents one of multiple paralogs that likely arose through gene duplication

  • Relationship to butyrophilin-like proteins:

    • Skint proteins are structurally related to the broader BTNL family

    • Human genomes contain BTNL genes but lack direct Skint orthologs

  • Functional homologs:

    • Despite sequence divergence, functional homologs exist across species

    • Human BTNL proteins perform similar roles in epithelial-T cell interactions

  • Selective pressures:

    • Rapid evolution suggests adaptation to species-specific epithelial challenges

    • Coevolution with T cell receptor genes points to specialized recognition systems

This evolutionary pattern suggests that while the specific sequence of Skint10 may not be conserved across species, the functional role of mediating epithelial-T cell interactions through "normality sensing" mechanisms represents a conserved immunological strategy for maintaining tissue homeostasis .

How can Skint10 research contribute to understanding tissue-specific immune regulation?

Skint10 research offers unique opportunities to advance our understanding of tissue-specific immune regulation:

  • Mapping epithelial-immune interfaces:

    • Characterizing Skint10-dependent macromolecular TCR aggregates

    • Defining molecular requirements for stable tissue residency

    • Identifying tissue-specific cues that program local immune cells

  • Understanding barrier immunity:

    • Elucidating how Skint10-T cell interactions maintain barrier integrity

    • Defining early warning systems for epithelial stress

    • Mapping how "normality sensing" transitions to stress responses

  • Developing targeted therapeutics:

    • Engineering Skint10-based approaches to modulate tissue-resident T cells

    • Designing strategies to strengthen epithelial barriers

    • Creating interventions that restore disrupted "normality sensing"

  • Modeling tissue-specific pathologies:

    • Using Skint10 manipulations to recapitulate barrier disorders

    • Investigating contributions to inflammatory skin conditions

    • Exploring connections to UV-induced carcinogenesis

By building on findings with related proteins like Skint1, researchers can use Skint10 to explore how epithelial tissues maintain immunological homeostasis through specialized interactions with resident lymphocyte populations, potentially revealing new therapeutic targets for inflammatory and neoplastic diseases .

What protocols are recommended for investigating Skint10-TCR interactions at the molecular level?

Investigating Skint10-TCR interactions at the molecular level requires sophisticated approaches:

  • Structural biology techniques:

    • X-ray crystallography of Skint10-TCR complexes

    • Cryo-electron microscopy for large macromolecular assemblies

    • NMR spectroscopy for dynamic interaction studies

  • Biochemical interaction assays:

    • Surface plasmon resonance to measure binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

    • Biolayer interferometry for real-time interaction analysis

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize TCR nanoclusters

    • FRET/FLIM to measure protein proximities

    • Single-molecule tracking to monitor dynamic interactions

  • Computational modeling:

    • Molecular dynamics simulations of Skint10-TCR complexes

    • In silico mutagenesis to predict critical interaction residues

    • Systems biology approaches to model signaling networks

Based on studies with Skint1, researchers should focus on how Skint10 induces and stabilizes TCR aggregation, as these macromolecular structures appear central to the "normality sensing" mechanism that licenses tissue-resident T cells for rapid responses to subsequent tissue perturbation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.