Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 11 (Skint11)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 11 (Skint11) is a protein encoded by the Skint11 gene in mice . Skint11 belongs to the Skint family of proteins, which are part of the immunoglobulin superfamily . These proteins are characterized by having immunoglobulin-like domains and multiple transmembrane domains . Skint11, like other Skint proteins, is expressed in the thymus and skin, suggesting a role in T-cell development and skin immunity .

Gene and Protein Structure

The Skint11 gene is located on chromosome 4 in mice . The Skint11 protein is predicted to have a signal sequence, IgV and IgC type immunoglobulin-like domains, three transmembrane domains (TMDs), and a short cytoplasmic C terminus . The protein is encoded by multiple exons, each corresponding to a distinct domain .

Expression and Function

Skint11 is expressed in the thymus and skin, and some paralogs also show expression in other tissues . Skint11 proteins are involved in the selection and maintenance of intraepithelial T cells . Specifically, Skint1 is essential for the development of dendritic epidermal T cells (DETC), a population of γδ T cells residing in the epidermis that contribute to immune surveillance .

Role in Immunity and Atopic Dermatitis

Skint11 and other Skint proteins may play a role in the development of atopic dermatitis (AD) . Allergic skin inflammation shares characteristics with human AD . Mouse models are used to study AD, but the complexity of AD presents a challenge in selecting an appropriate model, as no single murine model fully replicates all aspects of human AD .

Research Findings

Skint-1, a related protein, selectively regulates Vγ5Vδ1 + DETCs . Transgenic Skint-1 expression precisely and selectively determines the Vγ5Vδ1 + dendritic epidermal T-cell compartment . Skint-1 must be expressed by stromal cells to function efficiently, unlike lipid–CD1 complexes . The unusual transmembrane–cytoplasmic regions of Skint-1 limit cell surface expression, and increasing this or retaining Skint1 intracellularly markedly compromises function .

Skint-1 requires surface expression on thymic epithelial cells for DETC selection and depends on specific residues on the CDR3-like loop within the membrane-distal variable domain of Skint-1 (Skint-1 DV) .

Data Tables

PropertyDescription
Gene NameSkint11
Protein NameSelection and upkeep of intraepithelial T-cells protein 11 (Skint11)
Chromosome LocationChromosome: 4
Protein DomainsIgV, IgC, Transmembrane domains
ExpressionThymus, Skin
FunctionSelection and upkeep of intraepithelial T-cells
PurityGreater or equal to 85% purity as determined by SDS-PAGE
SpeciesMus musculus (Mouse)
3D StructureModBase 3D Structure for A7XV14

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Skint11; Selection and upkeep of intraepithelial T-cells protein 11; Skint-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-364
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Skint11
Target Protein Sequence
LDIQINTQIPDTEEGVLVECTAESLFPPAEMTWRDSKGNIIPPSSTFDSQDRAGLLCLKS TILLKNRTEGPITCSIYNKTTNQEKRRSIILSDVLFRPQYMSLMSNNLLYLGIYLIFILF LNFLKGILFCLTKRLVHFRKRMIKIKKVWSNKTRACCPLIWEFLEIVLFIAFLPLYLMFR IRVFTLDEAHILYNNWLWKVCKTLIAMMILFTVLILFLLWTLNRYGKMPCLSSMNIDVST HDAEQNSSKSAKFQENYDVAGQMILETYEETIFCQHQESCEEYNYDPLLLSSLDALGTCE DEKFSQHQESFEEDEDLQSFSDFKIELYSKLGNLTH
Uniprot No.

Target Background

Function
May function by interacting with a cell surface molecule on immature T-cells within the embryonic thymus.
Database Links

KEGG: mmu:230623

UniGene: Mm.124482

Protein Families
SKINT family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in skin and thymus.

Q&A

What is Skint11 and what is its basic function in mouse models?

Skint11 (Selection and upkeep of intraepithelial T cells 11) is a mouse protein encoded by the Skint11 gene (Gene ID: 230623). It belongs to the Skint family of proteins that are involved in the selection and maintenance of intraepithelial T lymphocytes (IELs) in epithelial tissues . These proteins are critical for the development and function of specialized T cell populations that reside within epithelial layers, particularly in the skin and intestinal mucosa. The protein has been characterized at the molecular level with mRNA Refseq NM_001166027.1 and Protein Refseq NP_001159499.1 .

How does Skint11 contribute to intraepithelial lymphocyte development?

Skint11, as a member of the Skint family, plays a role in the selection and maintenance of specific IEL populations. Research indicates that Skint proteins function in epithelial tissues to provide signals that support IEL development and homeostasis. In particular, they contribute to the selection processes that determine which T cell precursors will mature into functional IELs. This is critical for establishing the diverse repertoire of IELs that provide immunosurveillance at epithelial barriers. Intraepithelial lymphocytes isolated from mouse small intestine show distinct phenotypic characteristics, including expression of markers like CD103 and CD25, which may be influenced by Skint family proteins .

What are the common methods for isolating intraepithelial lymphocytes when studying Skint11 function?

When studying proteins involved in IEL biology such as Skint11, researchers typically isolate IELs using the following methodology:

  • Dissect the small intestine from experimental mice and remove Peyer's patches

  • Flush the intestine of fecal material and cut into small pieces (3-4 mm)

  • Process the tissue in media supplemented with FCS (10% v/v)

  • Use gentle mechanical disruption to release IELs from the epithelium

  • Purify the isolated cells through density gradient centrifugation or other separation techniques

This approach, as described by Montufar-Solis and Klein, allows for the extraction and analysis of IELs while preserving their phenotypic characteristics . Once isolated, these cells can be analyzed using flow cytometry to assess the expression of markers like CD103, CD25, and various T cell receptors, providing insights into how proteins like Skint11 might influence IEL populations.

What expression patterns of Skint11 are observed in different mouse tissues?

Skint11 expression is primarily observed in epithelial tissues, with particular emphasis on skin epithelium and intestinal mucosa. While the search results don't provide comprehensive tissue expression data specifically for Skint11, research on related Skint family members suggests these proteins are expressed in tissues where IELs reside. The presence of Skint11 in these tissues aligns with its proposed function in supporting IEL development and maintenance. Single-cell transcriptomics approaches have been valuable for identifying cell type-specific expression patterns in epithelial tissues, which could be applied to better understand Skint11 distribution .

What expression systems are optimal for producing recombinant mouse Skint11?

For recombinant mouse Skint11 production, mammalian expression systems are generally preferred to ensure proper protein folding and post-translational modifications. According to available product information, recombinant mouse Skint11 is typically expressed in mammalian cells rather than bacterial systems . This approach helps maintain the protein's native conformation and functional properties.

The production process typically involves:

  • Cloning the Skint11 gene sequence into an appropriate expression vector

  • Transfecting mammalian cells (commonly HEK293 or CHO cells)

  • Culturing cells under optimized conditions for protein expression

  • Harvesting and purifying the protein using affinity chromatography (often utilizing His-tags)

Expression in mammalian systems helps ensure that the recombinant Skint11 retains structural features that may be essential for functional studies, particularly when investigating interactions with T cell receptors or other immune components.

What purification strategies yield the highest purity for recombinant Skint11 protein?

For high-purity recombinant Skint11 protein, a multi-step purification process is recommended:

  • Affinity Chromatography: Using His-tag affinity as the primary capture step, as most commercially available recombinant Skint11 proteins feature His-tags .

  • Size Exclusion Chromatography: To separate the target protein from aggregates and lower molecular weight contaminants.

  • Ion Exchange Chromatography: As a polishing step to remove remaining impurities based on charge differences.

This approach typically yields recombinant Skint11 with >80% purity as determined by SDS-PAGE and Western blot analysis . For applications requiring ultra-high purity (>95%), additional chromatography steps may be necessary. The final purified protein should be extensively dialyzed against PBS buffer to remove any residual components from the purification process.

How should researchers validate the functionality of recombinant Skint11 protein?

Functional validation of recombinant Skint11 should include multiple complementary approaches:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm proper folding

    • Size exclusion chromatography to verify monodispersity

  • Binding Studies:

    • Surface plasmon resonance (SPR) to measure binding kinetics with known interaction partners

    • Co-immunoprecipitation assays with potential binding partners from IEL lysates

  • Functional Assays:

    • In vitro T cell activation assays measuring CD69 or CD25 upregulation

    • IEL development assays in thymocyte or bone marrow cultures

    • Migration assays to assess IEL homing capabilities

  • Cell-Based Validation:

    • Flow cytometry to evaluate binding to IEL populations

    • Ex vivo stimulation of IELs with the recombinant protein, measuring cytokine production

These validation steps ensure that the recombinant Skint11 protein maintains its native functions and can reliably be used in downstream research applications.

How can single-cell transcriptomics be leveraged to study Skint11 function in IEL development?

Single-cell RNA sequencing (scRNA-seq) offers powerful insights into Skint11's role in IEL development through these methodological approaches:

  • Cell Population Identification:

    • Isolate IELs from small intestine or skin of wild-type and Skint11-deficient mice

    • Perform droplet-based scRNA-seq to capture individual transcriptomes

    • Cluster cells based on gene expression profiles using packages like Seurat

    • Identify IEL subpopulations based on known markers (CD8αα, CD8αβ, γδ TCR, etc.)

  • Developmental Trajectory Analysis:

    • Apply pseudotime analysis using tools like Monocle3 or SoptSC to reconstruct developmental pathways

    • Map the differentiation trajectory of IEL precursors to mature IELs

    • Identify branch points where Skint11 may influence cell fate decisions

  • Differential Expression and Network Analysis:

    • Compare transcriptional profiles between control and Skint11-deficient IELs

    • Identify dysregulated gene networks and pathways

    • Use cellular entropy estimators to determine the stability of different IEL states

  • Integration with Spatial Information:

    • Combine scRNA-seq with spatial transcriptomics to understand how epithelial Skint11 expression correlates with IEL localization

    • Apply velocity vector analysis to infer future cellular states and differentiation dynamics

This multi-dimensional approach can reveal how Skint11 influences gene expression programs during IEL development, maturation, and maintenance within epithelial tissues.

What are the optimal experimental designs for investigating Skint11 function in mouse models?

Investigating Skint11 function in vivo requires carefully designed mouse models and experimental approaches:

  • Genetic Models:

    • Skint11 knockout mice (complete gene deletion)

    • Conditional knockout using Cre-loxP system to delete Skint11 in specific cell types

    • Knock-in reporter mice (e.g., GFP fusion) to track Skint11 expression

  • Experimental Design Strategies:

    • Age and sex-matched cohorts (minimum 8-10 mice per group)

    • Littermate controls to minimize genetic background effects

    • Blinded assessment of phenotypes

  • Phenotypic Analysis Pipeline:

    Analysis TypeTechniquesParameters Measured
    IEL ProfilingFlow cytometryCell numbers, subset distribution, activation markers
    Tissue AnalysisHistology, immunofluorescenceTissue architecture, IEL localization
    Functional AssessmentEx vivo stimulationCytokine production, proliferation
    Barrier FunctionFITC-dextran permeabilityEpithelial integrity
    Infection ChallengePathogen clearanceImmune response efficacy
  • Molecular Readouts:

    • RNA-seq of sorted IEL populations

    • ATAC-seq for chromatin accessibility changes

    • Proteomics to identify Skint11 interaction partners

This comprehensive approach allows for robust assessment of how Skint11 influences IEL development, maintenance, and function in physiological and pathological conditions.

How does Skint11 compare with other members of the Skint family in terms of structure and function?

While the search results don't provide comprehensive comparative information about all Skint family members, a structured comparison can be established based on available knowledge:

Structural Comparison:

  • Skint family proteins typically contain immunoglobulin-like domains in their extracellular regions

  • They share a common architecture with transmembrane domains that anchor them to the cell surface

  • Sequence homology analysis reveals conserved motifs among family members that likely relate to their shared functions in IEL biology

Functional Differentiation:

  • Different Skint family members may exhibit tissue-specific expression patterns

  • They likely have specialized roles in selecting and maintaining distinct IEL subsets

  • While some may function primarily in the skin (as suggested by the "Sk" in Skint), others may be more important in intestinal mucosa

A comparative analysis approach to study Skint family proteins would involve:

  • Generating expression constructs for multiple Skint family members

  • Performing parallel functional assays using identical experimental conditions

  • Using CRISPR/Cas9-mediated deletion of individual family members to assess non-redundant functions

  • Conducting cross-rescue experiments to determine functional overlap

Such analyses would help delineate the specific contribution of Skint11 within the broader Skint protein family context.

What are common challenges in detecting Skint11 expression and how can they be overcome?

Researchers often encounter several challenges when detecting Skint11 expression:

  • Low Abundance Issues:

    • Problem: Skint11 may be expressed at low levels in certain tissues or cell types.

    • Solution: Use highly sensitive detection methods such as RNAscope for mRNA or proximity ligation assays for protein detection. Employ signal amplification techniques like tyramide signal amplification for immunohistochemistry.

  • Antibody Specificity Concerns:

    • Problem: Commercial antibodies may cross-react with other Skint family members.

    • Solution: Validate antibodies using Skint11 knockout tissues as negative controls. Consider generating epitope-tagged Skint11 knock-in mice for detection with highly specific tag antibodies.

  • Temporal Expression Fluctuations:

    • Problem: Skint11 expression may vary during development or immunological challenge.

    • Solution: Perform time-course studies to identify optimal detection windows. Use inducible reporter systems to track expression dynamics in real-time.

  • Technical Detection Issues:

    IssueSolutionValidation Method
    Fixation sensitivityTest multiple fixation protocolsSide-by-side comparison of signal intensity
    Epitope maskingTry multiple antibody clones targeting different regionsWestern blot confirmation of detection
    RNA degradationUse RNase inhibitors and rapid tissue processingRT-qPCR with multiple primer sets
  • Single-cell Heterogeneity:

    • Problem: Bulk analysis may miss rare Skint11-expressing cells.

    • Solution: Implement single-cell RNA-seq or single-cell western blot techniques to capture cell-to-cell variation in expression .

These methodological refinements can significantly improve the detection sensitivity and specificity for Skint11 in experimental settings.

How can researchers address variability in IEL isolation when studying Skint11 function?

Variability in IEL isolation represents a significant challenge when studying proteins like Skint11. To ensure reproducible results:

  • Standardized Isolation Protocol:

    • Implement a consistent tissue processing timeline (≤30 minutes from sacrifice to cell isolation)

    • Standardize mechanical disruption parameters (force, duration, temperature)

    • Use consistent enzyme concentrations and incubation times if enzymatic digestion is employed

  • Quality Control Measures:

    • Assess cell viability (target >90%) using trypan blue exclusion or flow cytometry

    • Verify epithelial contamination levels using epithelial markers (E-cadherin, EpCAM)

    • Confirm IEL identity through flow cytometry for canonical markers before experiments

  • Technical Refinements:

    • Employ gentle isolation techniques to preserve fragile cell surface molecules like Skint11

    • Consider using organ culture approaches where epithelial structures remain intact

    • Implement a density gradient purification step to remove debris and enrich for lymphocytes

  • Data Normalization Strategies:

    • Include internal controls in each experiment

    • Normalize cell numbers to tissue weight or length

    • Use reference genes or proteins that remain stable across experimental conditions

  • Documentation and Reporting:

    • Record and report detailed methodological parameters including mouse age, sex, and fasting status

    • Document time delays between tissue collection and processing

    • Maintain consistent terminology when describing isolation procedures

Implementing these strategies can significantly reduce technical variability, enabling more reliable assessment of Skint11's biological functions in IEL populations.

What approaches help resolve contradictory data in Skint11 functional studies?

When faced with contradictory results in Skint11 research, systematic troubleshooting approaches should be employed:

  • Methodological Reconciliation:

    • Compare experimental protocols in detail, identifying subtle differences in procedures

    • Standardize key variables (protein concentration, cell numbers, incubation times)

    • Perform side-by-side comparisons using identical reagents and protocols

  • Biological Variable Assessment:

    • Examine mouse strain differences that might influence Skint11 function

    • Consider microbiome variations that could impact intestinal IEL populations

    • Evaluate housing conditions and diet as potential confounding factors

  • Technical Validation Framework:

    • Employ multiple complementary techniques to address the same question

    • Use orthogonal approaches for protein detection and functional assessment

    • Validate key findings in different laboratory settings if possible

  • Statistical and Experimental Design Improvements:

    • Increase sample sizes to address biological variability

    • Implement more sophisticated statistical models appropriate for complex biological data

    • Design experiments with adequate statistical power to detect effect sizes of biological significance

  • Data Integration Approaches:

    • Utilize single-cell technologies to resolve population heterogeneity that might explain discrepancies

    • Apply computational modeling to integrate diverse datasets and identify parameter sensitivities

    • Consider systematic literature review and meta-analysis methods to synthesize published findings

By methodically addressing contradictions through these approaches, researchers can develop a more nuanced understanding of Skint11 biology and resolve apparent conflicts in the literature.

How might novel organoid systems advance understanding of Skint11 function in epithelial-IEL interactions?

Organoid technology offers significant potential for studying Skint11 function in epithelial-IEL interactions through several innovative approaches:

  • Co-culture Systems:

    • Develop intestinal or skin organoids from wild-type or Skint11-modified mice

    • Incorporate isolated IELs into the organoid culture system

    • Monitor IEL-epithelial interactions in real-time using live imaging

  • Genetically Engineered Organoids:

    • Generate organoids with fluorescently tagged Skint11 to visualize protein localization

    • Create Skint11 knockout organoids using CRISPR/Cas9 technology

    • Develop inducible Skint11 expression systems to study temporal requirements

  • Single-cell Analysis Applications:

    • Apply scRNA-seq to organoid-IEL co-cultures to profile transcriptional changes

    • Track cell lineage trajectories during IEL integration into epithelial structures

    • Use entropy measurements to assess cellular state stability in the presence/absence of Skint11

  • Physiological Challenge Models:

    Challenge TypeReadoutRelevance to Skint11
    Barrier disruptionEpithelial recovery rateRole in tissue repair
    Pathogen exposureIEL activation statusFunction in immune response
    Inflammatory stimuliCytokine productionContribution to homeostasis
  • Translational Applications:

    • Adapt human organoid systems to study Skint family homologs

    • Test therapeutic targeting of Skint pathway for intestinal or skin disorders

    • Develop drug screening platforms using Skint11-dependent readouts

These organoid-based approaches offer unique advantages for studying Skint11 biology in a controlled yet physiologically relevant context, potentially revealing new aspects of IEL-epithelial crosstalk mediated by this protein.

What are promising therapeutic implications of understanding Skint11 function in immune regulation?

Understanding Skint11's role in immune regulation could have several therapeutic implications:

  • Intestinal Inflammatory Disorders:

    • Insights into how Skint11 regulates IEL homeostasis could inform new treatments for inflammatory bowel disease

    • Modulating Skint11 activity might help restore disrupted epithelial-immune balance in chronic inflammation

    • Therapeutic strategies targeting Skint11-mediated pathways could enhance barrier repair mechanisms

  • Skin Immunology Applications:

    • Understanding Skint11's function in epidermal T cell populations could lead to novel treatments for inflammatory skin conditions

    • Recombinant Skint11 or mimetic compounds might help modulate skin-resident T cell responses

    • Insights from skin organoid studies might translate to regenerative approaches for damaged epithelial barriers

  • Cancer Immunotherapy Potential:

    • IELs play crucial roles in immunosurveillance; understanding how Skint11 regulates their function could inform cancer immunotherapy approaches

    • Manipulating Skint11 signaling might enhance anti-tumor responses of tissue-resident lymphocytes

    • Combination approaches targeting both checkpoint inhibitors and Skint pathways could improve response rates

  • Biomarker Development:

    • Skint11 expression patterns or downstream signatures could serve as diagnostic or prognostic indicators

    • Monitoring Skint11-regulated pathways might help predict treatment responses

    • Changes in IEL populations associated with Skint11 function could indicate disease progression

These therapeutic directions require further validation through rigorous preclinical studies, but represent promising avenues for translating basic understanding of Skint11 biology into clinical applications.

How might integrating multiomics approaches advance Skint11 research beyond current limitations?

Integrating multiomics approaches can significantly advance Skint11 research by providing comprehensive molecular insights:

  • Integrated Genomics and Transcriptomics:

    • Combine genome-wide association studies with transcriptome profiling to identify genetic variants affecting Skint11 expression

    • Apply single-cell multimodal profiling (RNA + ATAC) to simultaneously assess gene expression and chromatin accessibility in Skint11-responsive cells

    • Implement trajectory inference methods to map developmental programs influenced by Skint11

  • Proteomics and Interactomics Integration:

    • Employ proximity labeling techniques (BioID, APEX) to identify the Skint11 interactome

    • Use mass spectrometry-based approaches to map post-translational modifications of Skint11

    • Integrate protein-protein interaction networks with transcriptional changes to build regulatory models

  • Spatial Technologies:

    • Combine single-cell transcriptomics with spatial profiling to map the distribution of Skint11-expressing cells and responding IELs

    • Implement multiplexed ion beam imaging or cyclic immunofluorescence to visualize protein interactions in situ

    • Use spatial transcriptomics to understand regional variations in Skint11 function across tissues

  • Systems Biology Framework:

    • Develop computational models integrating multiple data types to predict Skint11 function in various contexts

    • Apply machine learning approaches to identify patterns in complex multiomics datasets

    • Use network analysis to position Skint11 within broader immune regulatory systems

  • Longitudinal and Perturbation Studies:

    • Implement time-series multiomics to track dynamic changes in Skint11-dependent processes

    • Combine CRISPR screening with multiomics readouts to identify genetic dependencies

    • Integrate drug perturbation data with molecular profiles to identify intervention points

This multiomics strategy would address current limitations by providing context-rich information about Skint11 function across multiple biological scales, from molecules to cells to tissues, enabling a more comprehensive understanding of its role in immune regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.