Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 3 (Skint3)

Shipped with Ice Packs
In Stock

Description

Role of Skint Proteins in Immune Function

Skint proteins are members of an immunoglobulin superfamily and are primarily involved in the selection and maintenance of intraepithelial T cells. Skint1, the most studied member of this family, is crucial for the positive selection of Vγ5+Vδ1+ T cells in the thymus and their maintenance in the skin . These T cells are essential for epithelial barrier function and contribute to wound healing and immune surveillance.

Skint3 and Wound Healing

Recent research indicates that Skint family members, including Skint3 and Skint9, influence re-epithelialization during wound healing . Re-epithelialization is a critical phase of wound healing where the epithelial layer is restored, and Skint proteins may facilitate this process by supporting the function of intraepithelial T cells.

Research Findings on Skint3

While specific studies on Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 3 (Skint3) are scarce, its role in wound healing suggests that it may enhance the immune response and tissue repair by modulating intraepithelial T cell activity. Further research is needed to elucidate the precise mechanisms and functions of Skint3.

Comparison of Skint Proteins

ProteinPrimary FunctionExpressionRole in Immune Response
Skint1Positive selection of Vγ5+Vδ1+ T cellsThymus and skinEssential for γδ T cell development and maintenance
Skint3Influence on re-epithelialization during wound healingPresumably epithelial tissuesSupports intraepithelial T cell function in wound healing
Skint9Similar to Skint3, involved in wound healingEpithelial tissuesContributes to re-epithelialization and immune response

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, kindly indicate it in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Important: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipment, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development accordingly.
Synonyms
Skint3; Selection and upkeep of intraepithelial T-cells protein 3; Skint-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-458
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Skint3
Target Protein Sequence
SEQFTITGLERPVLAPLGGILELSCQLSPPQNAQQMEIRWFRNRYTEPVYLYRNGKDLHG ETISKYVERTELLKHDIGKGKVTLRVFKVTVDDDGSYHCVFKDGIFYEEHITEVKVTATS SDIKIIMHPPNIKGVMLECHSRGWFPQPHMEWRDSNGQVIPATSKSQSQDENKLFNMTMN LFADVGLHQIVTCYIQNLLTHQEESISIVLTGDLFSWKIDWILILSIIACVMIPYSMTSY LQQHLIHGSCSQRSHHWRKNAMVCMSSVIAIIGSMLILHLKQRVPISDQHFELDTLYLED ISVILCVVIVFNLKLNLLTYYRLERKYDGCTPGCKACFYILKIIIIILPFVFTFGCYNAI FLKYHQLQKKVSIPDPLYYFYTSWLVNMEMLGVFLVFFPTFINLIEFSQFIKTVPKPIWL CQENMREDDAIRHR
Uniprot No.

Target Background

Function
This protein is thought to function by interacting with a cell surface molecule on immature T-cells in the embryonic thymus.
Database Links
Protein Families
SKINT family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in skin and thymus.

Q&A

What is Skint3 and what is its role in skin immunology?

Skint3 belongs to the Selection and upkeep of intraepithelial T-cells (Skint) protein family, which are membrane-bound immunoglobulin superfamily proteins. The full-length mouse Skint3 protein consists of 458 amino acids with multiple domains including Ig variable (IgV) and Ig constant domains followed by three transmembrane regions .

Functionally, Skint3 participates in the maintenance of epidermal homeostasis through its interaction with intraepithelial T lymphocytes. Research demonstrates that Skint3 expressed by epidermal keratinocytes plays a crucial role in regulating dendritic epidermal T cells (DETCs), which are important in wound healing and immune surveillance . Unlike some immune markers, Skint3 appears to function not just in immune cell development but in ongoing tissue homeostasis throughout life.

How does Skint3 compare structurally and functionally with other Skint family proteins?

Skint3 shares structural similarities with other Skint family members while maintaining distinct functions:

Skint Family MemberKey Structural FeaturesPrimary FunctionsExpression Pattern
Skint1IgV domain with critical CDR3-like loopThymic selection of Vγ5Vδ1 T cellsThymic epithelial cells, keratinocytes
Skint3Three transmembrane regions, IgV domainEpidermal homeostasis, wound healingPrimarily epidermal keratinocytes
Skint9Similar to Skint3Wound healing (potentially stronger effect than Skint3)Epidermal keratinocytes

Skint1 is primarily known for its role in thymic selection of DETCs, as evidenced by the finding that Skint1-deficient mice fail to produce mature Vγ5Vδ1 T cells that migrate to the epidermis . In contrast, Skint3 appears more directly involved in wound healing, with knockdown studies showing significant impairment in re-epithelialization processes .

In which cell types and tissues is Skint3 expressed?

Skint3 shows a specific expression pattern:

  • Primary expression site: Epidermal keratinocytes in the skin

  • Expression level: Moderate under normal conditions, upregulated during wound healing in young mice

  • Cellular localization: Cell membrane of keratinocytes, particularly in the basal and suprabasal layers

  • Developmental timing: Expression begins during embryonic development and continues throughout adult life

Unlike some Skint family members that show broader expression patterns, Skint3 expression appears more restricted to the epidermis. This tissue-specific expression pattern aligns with its proposed function in maintaining skin homeostasis and facilitating proper wound healing responses .

What methods are most effective for detecting Skint3 expression in experimental settings?

Several complementary approaches can be employed for detecting Skint3, each with specific advantages:

Detection MethodApplicationsAdvantagesLimitationsRecommended Controls
RT-qPCRmRNA expression quantificationHigh sensitivity, quantitativeNo protein or spatial informationInclude Gapdh, β-actin as housekeeping genes
ImmunohistochemistryTissue localizationSpatial context preservedAntibody specificity issuesSkint3 knockout tissue, isotype controls
Western blottingProtein expressionQuantifiable, size verificationLoss of spatial informationRecombinant Skint3 protein as positive control
Flow cytometrySingle-cell analysisQuantitative at cell levelRequires tissue dissociationFMO controls, Skint3-negative cell lines
RNA-SeqTranscriptome-wide analysisComprehensive, unbiasedBioinformatic expertise neededInclude multiple biological replicates

For RT-qPCR, primers should target unique regions of Skint3 to avoid cross-reactivity with other Skint family members. When analyzing Skint3 expression in wound healing models, it's advisable to sample tissue at multiple timepoints (day 0, 1, 3, 5, 7 post-wounding) to capture the dynamic expression pattern .

How does conditional knockdown of Skint3 affect wound healing in mouse models?

Conditional knockdown of Skint3 in epidermal keratinocytes produces significant impairment of wound healing processes. Key findings from experimental models include:

ParameterControl (Scrambled shRNA)Skint3 KnockdownSkint9 Knockdown
Wound closure at day 590 ± 6%49 ± 5%22 ± 5%
DETC morphology at wound edgeNormal dendrite patternsIncreased dendrite numbersSimilar to Skint3 KD
DETC numbers at wound marginNormalModestly decreasedModestly decreased
Re-epithelialization rateNormalSignificantly impairedSeverely impaired

Methodology for these studies typically involves:

  • In utero transduction of mouse embryos with lentiviral vectors expressing Skint3-specific shRNAs

  • Verification of knockdown efficiency via qPCR at P55 (approximately 55 days after birth)

  • Administration of 4-6mm punch wounds to the dorsal skin

  • Measurement of wound closure rates over a 7-day period

  • Immunohistochemical analysis of wound edges for cellular composition and DETC morphology

The molecular mechanisms underlying these effects appear to involve altered communication between keratinocytes and DETCs, leading to impaired epithelial cell migration and reduced wound closure rates.

What is the relationship between STAT3 signaling and Skint3 expression?

Analysis of the Skint3 promoter region has revealed multiple conserved STAT3 (Signal Transducer and Activator of Transcription 3) binding motifs, suggesting direct transcriptional regulation. This relationship has been experimentally validated through several approaches:

  • Promoter analysis: MEME software analysis of upstream sequences (4000 bp from start codon) identified conserved motifs containing STAT3 consensus binding sites

  • IL-6 stimulation experiments: Treatment of keratinocytes with Interleukin-6, a canonical STAT3 activator, leads to:

    • Phosphorylation and nuclear translocation of STAT3 within 30 minutes

    • Significant upregulation of Skint3 transcription as measured by RT-qPCR

  • Age-related expression patterns:

    • IL-6 levels show 4.5-fold reduction in aged versus young keratinocytes after wounding

    • This correlates with reduced STAT3 activation and diminished Skint3 expression

    • Stat3-null mice display DETC and wound repair defects similar to Skint3 knockdown models

This regulatory relationship has significant implications for therapeutic approaches, suggesting that enhancing STAT3 signaling in aged skin might improve Skint3 expression and subsequently enhance wound healing outcomes in elderly individuals.

How do intraepithelial T cells interact with Skint3-expressing keratinocytes during immune responses?

The interaction between intraepithelial T cells (particularly DETCs) and Skint3-expressing keratinocytes represents a critical communication axis in skin immunity. This interaction involves:

  • Cellular proximity and contact:

    • DETCs reside in close association with basal keratinocytes in the epidermis

    • Their characteristic dendritic morphology facilitates simultaneous contact with multiple keratinocytes

  • Signaling mechanisms:

    • While direct binding of Skint3 to a DETC receptor has not been conclusively demonstrated, functional evidence suggests specific recognition

    • DETCs near Skint3-knockdown keratinocytes show altered dendrite morphology, with more numerous dendrites than in control conditions

    • This morphological change suggests altered activation state or signaling

  • Cytokine-mediated communication:

    • DETCs produce IL-13 which acts on keratinocytes to enable canonical epithelial cell stress responses

    • In the absence of IL-13 or canonical intraepithelial lymphocytes, the skin has a decreased ability to repair its barrier

    • IL-13 controls the rate of epithelial cell movement through the epidermis, which may complement Skint3's role in wound healing

  • Outcome of interaction:

    • Proper Skint3-DETC interaction facilitates normal DETC function and distribution

    • This maintains epidermal homeostasis and enables efficient wound healing responses

    • Disruption of this axis leads to impaired tissue repair and potentially increased susceptibility to skin cancers

This epithelial-immune cell communication network represents an important area for therapeutic targeting in wound healing disorders and skin cancers.

What are the methodological considerations when working with recombinant Skint3 protein in experimental systems?

When utilizing recombinant Skint3 protein for research applications, several critical factors must be considered:

  • Expression and purification strategies:

    • Recommended expression system: E. coli or mammalian cell lines depending on application

    • Purification approach: Affinity chromatography with appropriate tags (His, GST)

    • Current commercial preparations typically provide 50 μg quantities at high purity

    • Storage buffer typically contains Tris-based buffer with 50% glycerol

  • Protein stability considerations:

    • Store at -20°C for short-term or -80°C for extended storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

    • Reconstitution should be performed at 100 μg/mL in sterile PBS

  • Functional assay design:

    • Include both carrier-containing and carrier-free preparations for different applications

    • Bovine Serum Albumin (BSA) is typically added as a carrier protein to enhance stability

    • For applications where BSA might interfere, use carrier-free versions

    • Include appropriate positive and negative controls

  • Verification of activity:

    • Western blot confirmation of protein integrity before use

    • Functional verification through cell-based assays

    • Test multiple concentrations to establish dose-response relationships

  • Common pitfalls and solutions:

    • Protein aggregation: Add low concentrations of non-ionic detergents

    • Loss of activity: Minimize freeze-thaw cycles, maintain cold chain

    • Non-specific binding: Include appropriate blocking agents in assays

    • Inconsistent results: Standardize protein lot usage within experimental series

Careful attention to these methodological details will significantly enhance the reliability and reproducibility of experiments utilizing recombinant Skint3 protein.

How does aging affect Skint3 expression and function in skin homeostasis?

Aging significantly impacts Skint3 expression and function through multiple interconnected mechanisms:

ParameterYoung SkinAged SkinFunctional Consequence
Basal Skint3 expressionNormalReducedCompromised epithelial-DETC communication
Wound-induced Skint3 upregulationStrong inductionMinimal inductionImpaired wound healing response
IL-6 levels after woundingNormal4.5-fold reductionDecreased STAT3 activation
STAT3 signalingRobustDiminishedReduced Skint3 transcription
DETC numbers and morphologyNormalAlteredCompromised immune surveillance

Research has demonstrated that these age-related changes have significant consequences:

  • Wound healing deficits:

    • Aged skin shows delayed re-epithelialization similar to young Skint3-knockdown models

    • This correlates with insufficient Skint3 upregulation at wound margins

  • Molecular mechanisms:

    • STAT3 binding motifs in Skint3 promoters show reduced occupancy in aged skin

    • IL-6, an upstream activator of STAT3, is significantly reduced in aged skin after wounding

    • This creates a signaling deficiency that prevents normal Skint3 induction

  • Therapeutic implications:

    • Enhancing STAT3 signaling can stimulate Skint3 expression in aged skin

    • This approach has been shown to improve epidermal migration in experimental models

    • Targeting this pathway represents a potential intervention strategy for elderly individuals

These findings highlight the importance of the IL-6/STAT3/Skint3 axis in age-related skin pathology and provide a mechanistic framework for developing targeted interventions.

What differences exist in wound healing phenotypes between various Skint family knockout models?

Comparative analysis of different Skint family knockout models reveals distinct but overlapping phenotypes:

ModelWound Closure (Day 5)DETC PopulationDETC MorphologyPrimary Mechanism
Wild-type90 ± 6%NormalNormal dendritesN/A
Skint1-deficientSignificantly impairedSeverely reducedAbnormalDefective thymic selection of DETCs
Skint3 knockdown49 ± 5%Modestly reduced at wound edgeIncreased dendrite numbersImpaired keratinocyte-DETC communication
Skint9 knockdown22 ± 5%Modestly reduced at wound edgeSimilar to Skint3 KDSimilar to Skint3 but more severe

Key differences between these models include:

  • Developmental vs. functional effects:

    • Skint1 deficiency affects thymic development of DETCs, with the primary defect occurring during T cell selection

    • The complementarity determining region 3-like loop in the IgV domain of Skint1 is critical for DETC selection

    • In contrast, Skint3 and Skint9 knockdowns primarily affect the function of existing DETCs and keratinocytes in adult skin

  • Severity gradient:

    • Skint9 knockdown produces the most severe wound healing defect

    • Skint3 knockdown shows intermediate severity

    • This suggests some functional specialization among Skint family members

  • Methodological considerations:

    • Skint1 studies typically use germline knockout models

    • Skint3 and Skint9 studies often employ conditional knockdown in keratinocytes via lentiviral shRNA delivery

    • These different approaches may contribute to some of the observed phenotypic differences

These comparative insights help clarify the specific roles of individual Skint family members in skin homeostasis and wound healing.

How does the IL-13 signaling pathway interact with Skint3-mediated processes in skin?

The relationship between IL-13 signaling and Skint3 function represents an important area of current research. While direct regulatory interactions are still being elucidated, several parallel and potentially converging mechanisms have been identified:

  • Cellular sources and targets:

    • IL-13 is produced by intraepithelial lymphocytes (IELs) including DETCs

    • IL-13 receptors are expressed on keratinocytes

    • Skint3 is expressed by keratinocytes and recognized by DETCs

    • This creates a potential bidirectional communication circuit

  • Functional parallels:

    • IL-13 enables canonical epithelial cell stress responses

    • In the absence of IL-13 or canonical IELs, skin barrier repair is compromised

    • Similarly, Skint3 deficiency leads to impaired wound healing

    • Both pathways appear to regulate epithelial cell behavior during tissue repair

  • Mechanistic convergence:

    • IL-13 controls the rate of epithelial cell movement through the epidermis

    • This may complement or interact with Skint3's effects on keratinocyte migration

    • Both pathways have protective effects against cutaneous carcinogenesis

  • Potential interaction model:

    • DETCs may respond to Skint3 on keratinocytes by producing IL-13

    • IL-13 then acts back on keratinocytes to promote migration and repair

    • This creates a positive feedback loop that facilitates efficient wound healing

While additional research is needed to fully elucidate the relationship between these pathways, targeting both IL-13 and Skint3 may represent a synergistic approach for enhancing wound healing, particularly in aging or compromised skin.

What are the emerging technologies for studying Skint3 function in complex skin models?

Recent technological advances are providing new opportunities to study Skint3 in more physiologically relevant systems:

  • Three-dimensional innervated skin models:

    • Microfluidic chips with slope-based air-liquid interfacing culture

    • Spatial compartmentalization allowing co-culture of keratinocytes and sensory neurons

    • These systems recapitulate organized basal-suprabasal stratification and barrier function

    • Enable in situ imaging and functional analysis in a cell-type-specific manner

    • Could be adapted to include DETCs and study Skint3-mediated interactions

  • Single-cell genomic approaches:

    • Single-cell RNA sequencing to analyze heterogeneity in Skint3 expression

    • Spatial transcriptomics to map expression patterns within the tissue architecture

    • CRISPR-Cas9 screening to identify regulators and effectors of Skint3 signaling

  • Advanced imaging techniques:

    • Intravital microscopy to observe DETC-keratinocyte interactions in real-time in vivo

    • Super-resolution microscopy to visualize molecular clustering at cellular interfaces

    • Label-free imaging approaches to minimize interference with biological processes

These emerging technologies promise to provide deeper insights into the complex cellular and molecular interactions involving Skint3 in skin homeostasis and wound healing.

What therapeutic applications could emerge from understanding Skint3 biology?

Understanding Skint3 biology opens several promising therapeutic avenues:

  • Enhanced wound healing in elderly populations:

    • Targeting the IL-6/STAT3/Skint3 pathway to improve age-related wound healing deficits

    • Development of recombinant Skint3 or peptide mimetics as topical wound healing agents

    • STAT3-activating compounds to boost endogenous Skint3 expression

  • Treatment of chronic non-healing wounds:

    • Skint3-based therapies could address diabetic ulcers and pressure sores

    • Combined approaches targeting both Skint3 and IL-13 pathways

    • Cell-based therapies using genetically modified keratinocytes with enhanced Skint3 expression

  • Cancer immunotherapy applications:

    • Exploiting the protective effect of Skint3-DETC interactions against skin carcinogenesis

    • Enhancing immune surveillance through modulation of Skint3 signaling

    • Combination approaches with existing immunotherapies

  • Biomarker development:

    • Skint3 expression patterns as predictive markers for wound healing outcomes

    • Diagnostic applications for identifying patients at risk for poor wound healing

    • Monitoring therapeutic response to interventions targeting epithelial repair mechanisms

These potential applications highlight the translational significance of basic research into Skint3 biology and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.