Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 7 (Skint7)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Skint7; Selection and upkeep of intraepithelial T-cells protein 7; Skint-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-394
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Skint7
Target Protein Sequence
EKLRVTTPTRHLLARVGGQAELSCQVIPPHSVMHMEVRWFRSGHSQPVYLYRGGHKMSEE
AAPEYANRTEFVKEAIGEGKVSLRIHNINILDDGPYQCSFNGSGFIDAAIMNLNVTAVGL
ETEIHVQAPDADGVMVECNSGGWFPRPQMEWRDSKGATLPHSLKSYSQDEARFFYMKMTL
LLTNMSHGSIICCIFNPVTGEEKQTSIILANELFNRDRIWMESLASIVWIMLSVYILYII
CFYWRTGCASGCLSKCFCVVTSWPVQIVHLLFCTGTFFAIYLPHRSRVSLSDPQFPLYNN
WITELLFVILFLTICFALPIILLFIQFQFTSLTKWEKNKDGIMDQPRLGKAHETSSLYRK
KTGKSWEQEK
Uniprot No.
Target Background
Function
May function by interacting with a cell surface molecule on immature T-cells within the embryonic thymus.
Database Links
KEGG: mmu:328505
UniGene: Mm.226771
Protein Families
SKINT family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in skin, thymus, testis and, to a lower extent, bladder.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
