Recombinant Mouse Selection and upkeep of intraepithelial T-cells protein 8 (Skint8)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Skint8; Selection and upkeep of intraepithelial T-cells protein 8; Skint-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-397
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Skint8
Target Protein Sequence
EKLRVTTPTRHLLARVGGQAELSCQVIPPHSVMHMEVRWFRSGHSQPVYLYRGGHKMSEE AAPEYANRTEFVKEAIGEGKVSLRIYNINILDDGPYQCSFNDSGFIDVAIMNLNVTAVGL ETEIHVQAPDADGVMVECNTGGWFPRPQMEWRDSKGATLPHSLKSYSQDEARFFHMKMTL LLTNMSHGSIICCISNPVTGEEKQTSIILANELFNQDYLWVGIFPFSVLSLILFGVLPFI NSFFRSQGCASGCLSKCLPVVTSWPVQIVHFLVCSGVLFAVYLPHRYRVSLSDPQFPLYN NWITELLIVILFLTICFVLPITVLLLIKLSPTCLAKWEKNKDDIMDSQLGLGKAREASTL YEEQSRKSWEQEK
Uniprot No.

Target Background

Function
May function by interacting with a cell surface molecule on immature T-cells within the embryonic thymus.
Database Links

KEGG: mmu:639774

UniGene: Mm.248185

Protein Families
SKINT family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in skin, thymus, testis and, to a lower extent, bladder, brain, heart, kidney, mammary gland, small intestine and uterus.

Q&A

What is Skint8 and to which protein family does it belong?

Skint8 (Selection and upkeep of intraepithelial T-cells protein 8) is a transmembrane protein belonging to the B7 family-related molecules. It contains IgV-like and IgC-like domains in its extracellular region, similar to other B7 family members, and plays crucial roles in immune regulation. Bioinformatics analysis of Skint8 can be performed using the Clustal W program to analyze sequence alignment with other B7 family members. The protein's structural features, including leader peptide, transmembrane domain, and Ig-like domains, can be predicted using tools such as SignalP 4.0, TMHMM server version 2.0, and InterPro databases .

What is the primary immunological function of Skint8?

Skint8 functions primarily as a negative regulator of T cell activity. When expressed as a recombinant Skint8-IgG Fc (Skint8-Ig) fusion protein, it demonstrably inhibits T cell proliferation, activation, and cytokine production both in vitro and in vivo. This negative regulatory function positions Skint8 as an important immunomodulatory molecule with potential applications in controlling excessive T cell responses . The protein's inhibitory effects are observed across multiple T cell activation pathways, suggesting it may serve as a checkpoint molecule in T cell-mediated immunity.

How does Skint8 compare with other members of the Skint family?

While Skint8 shares structural similarities with other Skint family members such as Skint2, their functional roles may differ. All Skint family proteins are involved in the selection and maintenance of intraepithelial T cells, but each may have specialized functions. For instance, Skint2 has been characterized with a full amino acid sequence (SEKFTVTGLQRPVLAPLGGNVELSCQLSPPQQAQHMEIRWFRNRYREPVYLYRNGKDLHG...) and is known to be expressed in specific cellular contexts . Comparative analysis between Skint family members helps in understanding their evolutionary relationships and specialized functions in intestinal immunity.

What expression systems are most effective for producing recombinant Skint8 protein?

For successful expression of recombinant Skint8, mammalian expression systems, particularly HEK-293 cells, have proven highly effective. The optimal approach involves cloning the IgV- and IgC-like domains (amino acids 26-233) of the Skint8 extracellular region and fusing them into a pCMV6-AC-FC-S expression vector containing the constant region of mouse IgG2a. Alternative approaches include expressing either the IgV-like domain (amino acids 26-142) or the IgC-like domain (amino acids 159-233) independently. After transfection into HEK-293 cells, secreted fusion proteins can be harvested from the supernatant for further purification .

What purification strategy yields the highest purity of recombinant Skint8-Ig fusion protein?

The most effective purification approach for Skint8-Ig fusion protein utilizes Protein G Sepharose 4 Fast Flow affinity chromatography. This method capitalizes on the high affinity of Protein G for the Fc portion of the fusion protein. Following purification, verification steps should include SDS-PAGE with Coomassie Blue staining and Western blot analysis using anti-IgG2a antibodies. Protein quantification can be accurately performed using the Pierce BCA Protein Assay Kit. The purified protein often displays a higher molecular weight than predicted, suggesting post-translational modifications such as glycosylation .

What are the optimal storage conditions for preserving Skint8 recombinant protein activity?

Based on established protocols for similar proteins like Skint2, recombinant Skint8 should be stored in a Tris-based buffer containing 50% glycerol, optimized for protein stability. For short-term storage, keeping working aliquots at 4°C for up to one week is acceptable. For long-term storage, the protein should be kept at -20°C, or preferably at -80°C for extended periods. Repeated freeze-thaw cycles should be avoided to prevent protein degradation and activity loss . Creating multiple small-volume aliquots during initial preparation helps minimize freeze-thaw damage to the protein.

How can researchers design T cell inhibition assays using recombinant Skint8?

To evaluate the inhibitory effects of Skint8 on T cells, researchers should design assays that measure T cell proliferation, activation, and cytokine production. A standard approach involves isolating CD3+, CD4+, or CD8+ T cells from C57BL/6 mice using immunomagnetic separation (achieving >95% purity). These T cells can then be stimulated with anti-CD3 antibody alone or in combination with anti-CD28 antibodies in the presence of either Skint8-Ig or control Ig. The proliferative response can be quantitatively assessed by pulsing the culture with [3H] thymidine 12 hours before harvest and measuring incorporated radioactivity . Flow cytometry analysis of activation markers and ELISA measurement of cytokine levels provide additional parameters for comprehensive evaluation.

What approaches can be used to identify the receptor for Skint8 on immune cells?

Identifying the receptor for Skint8 requires multiple complementary approaches. Start with flow cytometry using fluorescently labeled Skint8-Ig fusion protein to detect binding to various immune cell populations, including T cells, B cells, monocytes, and dendritic cells, in both resting and activated states. Compare binding patterns between wildtype and knockout/knockdown models to confirm specificity. Follow with immunoprecipitation and mass spectrometry to identify binding partners. Cross-linking studies using cell-impermeable crosslinkers followed by Western blotting can reveal direct interactions. Receptor expression patterns can be confirmed by observing that activated T cells, B cells, monocytes, and dendritic cells express the putative Skint8 receptor at different levels .

What methods are recommended for studying Skint8's role in intraepithelial lymphocyte development?

To investigate Skint8's role in intraepithelial lymphocyte (IEL) development, researchers should employ complementary in vivo and in vitro approaches. In vivo studies can utilize Skint8 knockout or transgenic overexpression mouse models to analyze IEL population changes, particularly focusing on TCRαβ+ CD8αα+ IELs. Flow cytometry analysis should incorporate markers including CD3, CD8α, CD8β, TCRαβ, TCRγδ, CD45, and tissue-specific markers. For mechanistic studies, examine the role of IL-15 and E8I enhancers in Skint8-mediated effects since these factors are known to be required for the development of TCRαβ+ CD8αα+ IELs . In vitro thymic organ culture systems can complement these approaches by allowing controlled manipulation of Skint8 expression during T cell development.

How can researchers accurately distinguish between the effects of Skint8 and other Skint family members?

Distinguishing between the effects of different Skint family members requires sophisticated experimental designs. First, establish selective gene knockdown or knockout models for individual Skint family proteins using CRISPR-Cas9 technology. Design domain-swapping experiments to identify functional regions unique to Skint8. Create highly specific antibodies against each Skint family member by immunizing with unique epitopes and extensively cross-adsorbing antisera. For functional studies, use specific recombinant proteins of each family member at equivalent concentrations to compare their effects on T cell responses. Comparison of expression patterns in different tissues and cell types using RT-qPCR and immunohistochemistry can reveal distinct physiological roles .

What are the critical considerations for interpreting in vivo Skint8 administration experiments?

When interpreting in vivo Skint8 administration experiments, researchers must account for several critical factors. First, consider the pharmacokinetics and biodistribution of the Skint8-Ig fusion protein, which will differ from native Skint8 due to the Fc region. Establish appropriate dosing regimens based on half-life determinations. Include proper controls such as equivalent concentrations of control IgG2a Fc protein. Monitor for potential immune reactions against the fusion protein itself, particularly in multi-dose studies. Examine tissue-specific effects, focusing on intestinal tissues where IELs reside. Use both wildtype and immunodeficient mouse models to dissect the mechanisms of action. Finally, analyze not only direct T cell effects but also secondary consequences on intestinal barrier function and microbiome composition .

How can researchers address potential artifacts in Skint8 functional studies?

To minimize artifacts in Skint8 functional studies, researchers should implement several control measures. For recombinant protein studies, compare the effects of full-length Skint8-Ig with separated IgV-like and IgC-like domains to identify domain-specific functions. Use blocking antibodies against potential Skint8 receptors to confirm specificity of observed effects. Include concentration gradients in all functional assays to establish dose-response relationships. When using genetic approaches, employ both conditional and inducible systems to distinguish between developmental and acute effects. Validate key findings using complementary techniques (e.g., confirm in vitro observations with in vivo models). Consider species differences when translating findings between mouse and human systems. Finally, use advanced statistical approaches like principal component analysis to distinguish true biological effects from technical variability .

How does Skint8 contribute to the maintenance of intestinal immune homeostasis?

Skint8 contributes to intestinal immune homeostasis through several interconnected mechanisms. As a negative regulator of T cell activation, it helps prevent excessive T cell responses to commensal microbiota and dietary antigens. Skint8 likely influences the development and function of intraepithelial lymphocytes (IELs), which are crucial immune regulators in the gut. IELs play essential roles in various intestinal diseases, including infections and inflammatory conditions, serving as first-line immune regulators at epithelial surfaces . By potentially modulating TCRαβ+ CD8αα+ IEL populations, Skint8 may contribute to the balance between protective immunity and immunological tolerance in the intestinal mucosa.

How might Skint8 interact with other epithelial immune regulators like HVEM?

Skint8 likely functions as part of a complex network of epithelial immune regulators, potentially interacting with molecules like HVEM (Herpesvirus entry mediator). HVEM expression in intestinal epithelia is known to maintain intraepithelial T cell survival and contributes to intestinal immune homeostasis . Both Skint8 and HVEM may cooperatively regulate IEL populations through complementary or overlapping mechanisms. Their interactions could occur at several levels: direct protein-protein interactions, shared downstream signaling pathways, or coordinated expression in response to environmental stimuli. Research exploring the combinatorial effects of these molecules would provide insights into the integrated regulation of intestinal immunity and potentially reveal synergistic therapeutic targets for intestinal inflammatory conditions.

What recombinant antibody technologies are most appropriate for Skint8 studies?

For Skint8 studies, selecting appropriate recombinant antibody technologies is crucial. Scalable methods for developing high-affinity, specific monoclonal antibodies include immunizing mice with pools of antigens containing Skint8 ectodomains expressed in mammalian cells. The functionally rearranged light and heavy chains from hybridoma cells can be cloned into a single expression plasmid, allowing for increased throughput antibody production. When screening antibodies, prioritize those that recognize formalin-resistant epitopes for compatibility with fixed tissue analysis. The immunoglobulin expression vector can be constructed from derivatives like pTT3 with expanded multiple cloning sites, incorporating the leader sequence of mouse variable κ light chain and the constant region of mouse IgG1 .

What are the best approaches for studying Skint8 in the context of intestinal tissue?

Studying Skint8 in intestinal tissue requires specialized approaches. For imaging studies, use monoclonal antibodies selected for their ability to work on wholemount fixed tissues. These antibodies should be validated to give expected staining patterns on fixed tissues while maintaining high affinity and selectivity . For functional studies, implement intestinal organoid cultures derived from mouse small intestine crypts, which maintain the cellular diversity and spatial organization of the intestinal epithelium. Analyze Skint8's effects on IEL populations using flow cytometry, focusing particularly on TCRαβ+ CD8αα+ IELs, which can be identified through markers including CD3, CD8α, CD8β, TCRαβ, and tissue-specific markers . Complement these approaches with in vivo studies using intestinal loop models or oral administration of Skint8-specific antibodies.

How can researchers effectively design and validate Skint8 knockout or transgenic mouse models?

Effective design of Skint8 genetic models requires careful consideration of multiple factors. For knockout models, use CRISPR-Cas9 to target critical exons encoding functional domains like the IgV-like domain. Include LoxP sites flanking essential exons to enable conditional deletion in specific tissues or developmental stages when using Cre-recombinase expressing mouse lines. For transgenic overexpression, use intestinal epithelial-specific promoters like villin to achieve targeted expression. Validate models at multiple levels: confirm gene modification by sequencing, verify protein absence/overexpression by Western blot and immunohistochemistry, and assess functional consequences by examining IEL populations and intestinal immune responses. Include littermate controls in all experiments to minimize genetic background effects. Monitor for potential compensatory upregulation of other Skint family members, which could mask phenotypes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.