Recombinant Mouse Selenoprotein S (Sels)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Selenos; H47; Vimp; Selenoprotein S; SelS; Minor histocompatibility antigen H47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MDRDEEPLSARPALETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQ RQLDQAETVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWD SMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPG RRGPSSGGUN
Uniprot No.

Target Background

Function
Selenoprotein S (SelS) plays a crucial role in the degradation pathway of misfolded endoplasmic reticulum (ER) luminal proteins. It facilitates the transfer of these misfolded proteins from the ER to the cytosol, where they undergo proteasomal degradation via a ubiquitin-dependent mechanism. SelS likely acts as a bridge between DERL1 (mediating retrotranslocation to the cytosol) and the VCP ATPase complex (mediating translocation and ubiquitination).
Gene References Into Functions
  1. SelS protects endothelial cells against TNF-α-induced dysfunction by inhibiting p38 MAPK and NF-κB pathway activation, suggesting a potential role in modulating vascular inflammatory diseases. PMID: 29805311
  2. Reduced Seps1 expression exacerbates inflammation specifically in fast-twitch muscle fibers, which are prone to degeneration in muscular dystrophy. PMID: 28592916
  3. Proline residues 178 and 183 in SelS are essential for p97(VCP) translocation to the ER membrane and protection against ER stress. PMID: 24700463
  4. SelS expression is predominantly observed in neurons, with minimal expression in astrocytes of control mice. PMID: 21456042
  5. Seps1 protein expression is significantly increased in the liver of septic mice. PMID: 20979832
  6. During the acute-phase response, selenoprotein biosynthesis shifts in hepatocytes, favoring SepS expression over other selenoproteins (e.g., SepP), leading to reduced serum selenium and improved liver function. PMID: 20370716
  7. SEPS1 acts as an ER stress-dependent survival factor, protecting macrophages from ER stress-induced dysfunction. PMID: 17210132
  8. SEPS1 suppression via siRNA significantly increases astrocyte injury from oxygen-glucose deprivation (OGD), suggesting a protective role against ischemia. PMID: 18498015
Database Links
Protein Families
Selenoprotein S family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is mouse Selenoprotein S and what are its primary functions?

Mouse Selenoprotein S is a selenocysteine-containing transmembrane protein primarily localized to the endoplasmic reticulum (ER). It plays critical roles in multiple cellular processes, including:

The ER-associated protein degradation (ERAD) pathway, where it forms part of a complex that facilitates retrotranslocation of misfolded proteins from the ER to the cytosol for proteasomal degradation. This function is particularly important during ER stress conditions, which can be experimentally induced using agents like tunicamycin and thapsigargin in model systems such as mouse neuroblastoma cells .

Selenoprotein S also contributes to cellular antioxidant defense mechanisms. As part of the broader selenoprotein family, it helps maintain redox homeostasis, with disruption of selenoprotein synthesis leading to increased vulnerability to oxidative stress and lipid peroxidation .

Additionally, Selenoprotein S participates in inflammatory regulation, potentially through its effects on ER stress signaling pathways that intersect with cytokine production networks. This connection to immune function is supported by findings that selenoprotein deficiency affects B lymphocyte development and hematopoietic stem cell function .

How does the selenocysteine incorporation mechanism work in mouse Selenoprotein S?

The incorporation of selenocysteine into mouse Selenoprotein S involves a complex molecular machinery that redefines the UGA codon (normally a stop codon) to specify selenocysteine instead. This process requires several key components:

The UGA codon in the Selenoprotein S mRNA must be accompanied by a specific RNA structure called the Selenocysteine Insertion Sequence (SECIS) element located in the 3' untranslated region. While some selenoproteins like selenoprotein P contain multiple UGA codons requiring two SECIS elements , Selenoprotein S typically contains a single selenocysteine residue and a single SECIS element.

A specialized selenocysteine tRNA (tRNA^Sec) charged with selenocysteine is essential for this process. When the gene encoding this tRNA (Trsp) is knocked out in mouse models, selenoprotein synthesis is disrupted across all selenoproteins .

The efficiency of selenocysteine incorporation is regulated by selenium availability and can be dynamically adjusted in response to cellular conditions . This regulation contributes to the prioritization of different selenoproteins when selenium is limiting.

Additional protein factors including SECIS-binding protein 2 (SBP2), selenocysteine-specific elongation factor (eEFSec), and ribosomal protein L30 are required to facilitate the complex interactions between the ribosome, the SECIS element, and the selenocysteine-charged tRNA^Sec.

What expression patterns does mouse Selenoprotein S exhibit across different tissues?

Mouse Selenoprotein S demonstrates a distinctive expression pattern across various tissues, with notable tissue-specific regulation. This expression profile provides insights into its physiological functions:

Tissue/Cell TypeRelative Expression LevelFunctional Significance
Immune cells (B lymphocytes)HighCritical for B cell development and immune function
Hematopoietic stem cellsModerate to highMaintains stemness and self-renewal capacity
LiverHighInvolved in metabolic regulation and ER stress response
Brain (including neuronal cells)ModerateStudied in neuroblastoma cells for ER stress response
PancreasModeratePotential role in diabetes and ER stress
Adipose tissueModerateImplicated in metabolic regulation
Skeletal muscleLow to moderateLimited functional studies available

The expression of Selenoprotein S is dynamically regulated by various stressors. ER stress inducers like tunicamycin and thapsigargin have been shown to alter its expression in neuroblastoma cells . Additionally, oxidative stress conditions may upregulate Selenoprotein S as part of the cellular antioxidant defense system, similar to the regulation observed for other selenoproteins .

What cellular compartments contain Selenoprotein S?

Mouse Selenoprotein S exhibits specific subcellular localization that reflects its functional roles in cellular homeostasis:

Selenoprotein S is primarily localized to the endoplasmic reticulum (ER) membrane as a transmembrane protein. Its topological orientation places the N-terminus in the cytosol and the C-terminus in the ER lumen, positioning it ideally to participate in ER-associated protein degradation (ERAD) processes.

Within the ER membrane, Selenoprotein S forms functional complexes with other ERAD components, including p97(VCP), Derlin-1, and VIMP. This complex formation is crucial for its role in extracting misfolded proteins from the ER for cytosolic degradation .

Some studies have suggested additional localization to the plasma membrane in specific cell types, though at significantly lower abundance than in the ER. This plasma membrane pool may have distinct functions from its ER counterpart.

There is emerging evidence for Selenoprotein S presence in mitochondria-associated ER membranes (MAMs), suggesting potential roles in ER-mitochondria communication and calcium signaling regulation.

The subcellular distribution of Selenoprotein S can be visualized through immunofluorescence microscopy using specific antibodies or by expressing tagged versions of the protein, though care must be taken to ensure that tags do not disrupt proper localization.

How does oxidative stress affect mouse Selenoprotein S function and expression?

The relationship between oxidative stress and mouse Selenoprotein S involves complex regulatory mechanisms and functional adaptations:

Oxidative stress typically induces upregulation of Selenoprotein S expression as part of the cellular adaptive response. This response pattern parallels that observed in other selenoproteins, which form a critical component of the cellular antioxidant defense system. The selenium-containing residue in Selenoprotein S may directly participate in redox reactions, neutralizing reactive oxygen species.

At the molecular level, oxidative stress activates the nuclear factor erythroid 2-related factor 2 (NRF2) transcription factor, which regulates antioxidant response. In selenoprotein-deficient models, NRF2 pathway activation is observed as a compensatory mechanism . This suggests that Selenoprotein S and other selenoproteins work in concert with NRF2-regulated genes to maintain redox homeostasis.

Oxidative stress conditions, particularly those leading to lipid peroxidation, can have more severe consequences in cells with compromised selenoprotein function. Studies of selenoprotein-deficient models demonstrate increased vulnerability to ferroptosis, a form of regulated cell death driven by lipid peroxidation .

Similar to selenoprotein W, Selenoprotein S may undergo post-translational modifications under oxidative stress conditions. Selenoprotein W undergoes S-glutathionylation at specific cysteine residues during oxidative stress , and analogous modifications might occur in Selenoprotein S, potentially regulating its function or stability.

The functional implications of these oxidative stress-induced changes in Selenoprotein S include altered capacity for managing ER stress, modified interaction with protein partners in the ERAD machinery, and potential impacts on inflammatory signaling pathways.

What role does Selenoprotein S play in ER stress response?

Selenoprotein S serves as a critical component of the cellular response to endoplasmic reticulum (ER) stress through several interconnected mechanisms:

As a core component of the ERAD machinery, Selenoprotein S forms a complex with other proteins including Derlin-1, p97 ATPase, and VIMP to facilitate the retrotranslocation of misfolded proteins from the ER lumen to the cytosol for proteasomal degradation . This process is essential for relieving ER stress caused by protein misfolding and aggregation.

During experimentally induced ER stress using agents like tunicamycin (which inhibits N-linked glycosylation) and thapsigargin (which disrupts ER calcium homeostasis), Selenoprotein S activity becomes particularly important for cell survival . These experimental approaches are commonly used to study Selenoprotein S function in cell culture models such as mouse neuroblastoma (N2a) cells.

The expression of Selenoprotein S itself is regulated by ER stress through the unfolded protein response (UPR). The Selenoprotein S gene promoter contains binding sites for UPR-activated transcription factors, allowing its upregulation during ER stress to enhance ERAD capacity.

Selenoprotein S may also influence ER stress through its antioxidant properties, as ER stress and oxidative stress are intimately connected. The redox-active selenocysteine residue could participate in maintaining the appropriate redox environment in the ER for proper protein folding.

Beyond protein quality control, Selenoprotein S impacts ER stress-induced inflammatory signaling pathways, potentially through interactions with components of the NF-κB pathway or through modulation of calcium signaling, which connects ER stress to inflammatory responses.

How does Selenoprotein S interact with other proteins in the ERAD pathway?

Selenoprotein S engages in specific protein-protein interactions within the endoplasmic reticulum-associated degradation (ERAD) pathway that are essential for its function in protein quality control:

Selenoprotein S forms a functional complex with several key ERAD components, including the p97(VCP) ATPase, which provides the mechanical force needed for extracting misfolded proteins from the ER membrane . This interaction is critical for the physical retrotranslocation process and may involve direct binding between Selenoprotein S and p97(VCP) or could be mediated through adaptor proteins.

The N-terminal cytosolic domain of Selenoprotein S interacts with the Derlin-1 protein, which forms a channel-like structure in the ER membrane. This interaction helps position Selenoprotein S optimally for its role in retrotranslocation.

Selenoprotein S also associates with VIMP (VCP-interacting membrane protein), which serves as an adaptor linking the p97(VCP) ATPase to the ER membrane components of the ERAD machinery.

E3 ubiquitin ligases, such as HRD1 and gp78, interact with this complex to catalyze the ubiquitination of misfolded proteins as they emerge on the cytosolic side of the ER membrane. This ubiquitination marks the proteins for recognition by the proteasome.

The selenocysteine residue in Selenoprotein S may influence these protein-protein interactions through its unique redox properties, potentially serving as a regulatory switch that responds to changing ER redox conditions.

These interactions can be studied using techniques such as co-immunoprecipitation, proximity labeling methods, or fluorescence resonance energy transfer (FRET) approaches, providing insights into both static and dynamic aspects of these protein complexes.

What are the phenotypic consequences of Selenoprotein S deficiency in mouse models?

Studies of Selenoprotein S deficiency in mouse models have revealed tissue-specific and context-dependent phenotypes that illuminate its physiological roles:

B lymphocyte development is particularly affected by selenoprotein deficiency, with Selenoprotein S likely playing a key role in this process. Knockout models show B lymphocytopenia, demonstrating the importance of selenoproteins in B-lineage maturation .

Hematopoietic stem cells (HSCs) from selenoprotein-deficient mice exhibit reduced self-renewal capacity and long-term reconstitution ability, as demonstrated through competitive transplantation experiments. Serial transplant assays reveal a profound loss of donor-derived chimerism in all lineages, indicating impaired HSC maintenance .

The phenotypic effects of selenoprotein deficiency are distinctly lineage-dependent. While B lymphocytes and HSCs are severely affected, myeloid cells show negligible effects, suggesting cell-type specific roles or compensatory mechanisms .

At the molecular level, Selenoprotein S deficiency leads to increased lipid peroxidation and vulnerability to ferroptosis, a form of regulated cell death. This phenotype is exacerbated with aging but can be ameliorated by treatment with ferroptosis inhibitors such as vitamin E .

Intriguingly, selenoprotein deficiency induces features reminiscent of aging in HSCs and pre-B cells, including upregulation of aging-related genes. Selenoprotein S may therefore play a protective role against certain aspects of cellular aging .

B-lineage cells from selenoprotein-deficient mice show a unique potential for myeloid lineage switching, with ectopic expression of myeloid genes in pre-B cells and the ability of pro-B/pre-B cells to differentiate toward CD11b+ myeloid cells in transplantation models .

How can researchers distinguish between different isoforms of mouse Selenoprotein S?

Distinguishing between different isoforms of mouse Selenoprotein S requires specialized techniques that can detect subtle variations in protein structure and expression:

Multiple Selenoprotein S isoforms may arise from alternative splicing events or the use of different transcription start sites. Bioinformatic analysis suggests that selenoprotein S mRNAs with different 5' sequences can yield products with different N-termini . These structural variations may affect protein function, localization, or interaction partners.

Western blotting using antibodies targeting different regions of the protein can distinguish isoforms that differ in size. Higher resolution techniques such as 2D gel electrophoresis can separate isoforms that differ in post-translational modifications or charge.

Mass spectrometry offers the most definitive approach for characterizing Selenoprotein S isoforms. Techniques similar to those used for identifying selenoproteins in other studies can reveal precise differences in amino acid sequence, post-translational modifications, or selenocysteine incorporation between isoforms.

Isoform-specific mRNA detection can be achieved through reverse transcription PCR (RT-PCR) or quantitative PCR (qPCR) using primers designed to specifically amplify each isoform. Northern blotting can also visualize different mRNA variants.

The functional significance of different isoforms can be assessed by selectively expressing each isoform in cell culture models and evaluating their subcellular localization, protein interaction profiles, and ability to rescue phenotypes in Selenoprotein S-deficient cells.

Creating isoform-specific knockout mouse models using CRISPR-Cas9 technology would allow researchers to determine the unique physiological roles of each isoform in vivo, similar to approaches used to study SECIS element mutations in selenoprotein P .

What are the optimal conditions for expressing recombinant mouse Selenoprotein S?

Expressing recombinant mouse Selenoprotein S requires specialized systems and conditions to ensure proper selenocysteine incorporation and protein folding:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, simple handlingRequires selenocysteine machinery co-expressionCo-transform with pSUABC plasmid containing selA, selB, selC; supplement media with 5-10 μM sodium selenite; induce at lower temperature (16-20°C)
Mammalian (HEK293)Proper folding, native post-translational modificationsLower yield, more expensiveCulture in DMEM with 10% FBS ; supplement with 50-100 nM sodium selenite; optimize transfection conditions; create stable cell lines
Insect cellsHigher yield than mammalian, proper foldingRequires baculovirus systemSupplement media with selenium; optimize MOI and harvest time
Cell-freeRapid production, simplified purificationLower yield, expensiveInclude selenocysteine incorporation machinery; optimize redox conditions

Regardless of the expression system, several factors are critical for successful production:

Selenium supplementation is essential in all systems to ensure sufficient selenocysteine incorporation. The optimal concentration depends on the expression system, with mammalian cells typically requiring lower concentrations (50-100 nM) than bacterial systems (1-10 μM).

For E. coli expression, co-expression of selenocysteine incorporation machinery (selenocysteine synthase, elongation factor, and tRNA) is necessary, as bacteria use a different mechanism for selenocysteine incorporation than eukaryotes.

The presence of the correct SECIS element in the expression construct is critical for mammalian and insect cell systems. The native mouse Selenoprotein S SECIS element should be retained in the 3' UTR of the expression construct.

For purification, affinity tags (His, FLAG, or GST) can be added, preferably at the N-terminus to avoid interfering with the C-terminal region. Purification typically involves affinity chromatography followed by ion-exchange chromatography as demonstrated for other selenoproteins .

How can selenocysteine incorporation be verified in recombinant Selenoprotein S?

Verification of selenocysteine incorporation in recombinant mouse Selenoprotein S requires multiple complementary approaches to ensure the presence and functionality of this critical residue:

Mass spectrometry provides the most direct evidence of selenocysteine incorporation. Techniques such as microcapillary reverse-phase HPLC nano-electrospray tandem mass spectrometry (μLC/MS/MS) can identify peptides containing selenocysteine and distinguish them from cysteine-containing peptides based on their mass difference . The characteristic isotope pattern of selenium also aids in identification.

Metabolic labeling with radioactive 75Se offers a highly specific approach to confirm selenium incorporation. Cells expressing recombinant Selenoprotein S are cultured in medium containing 75Se, and the resulting labeled proteins are analyzed by SDS-PAGE followed by autoradiography or phosphorimaging . Only proteins containing selenocysteine will be radioactively labeled.

Functional assays can provide indirect evidence of selenocysteine incorporation. Since the selenocysteine residue is often critical for the redox activity of selenoproteins, comparing the activity of wild-type Selenoprotein S with a variant where selenocysteine is replaced by cysteine can indicate successful incorporation.

Molecular weight comparison between recombinant proteins expressed with and without selenium supplementation can indicate selenocysteine incorporation, as premature termination at the UGA codon in the absence of selenium would result in a truncated protein.

Resistance to oxidative stress-induced aggregation can also serve as a functional indicator of selenocysteine incorporation, as the selenol group in selenocysteine is less prone to oxidation-induced crosslinking compared to the thiol group in cysteine.

What cell culture models are most appropriate for studying mouse Selenoprotein S function?

Several cell culture models offer distinct advantages for investigating different aspects of mouse Selenoprotein S function:

Mouse neuroblastoma (N2a) cells provide an excellent model for studying Selenoprotein S in a neuronal context, particularly in relation to ER stress responses. These cells can be treated with tunicamycin (1 μg/ml) or thapsigargin (100 nM) to induce ER stress and study how Selenoprotein S responds to and modulates these conditions .

HEK293 cells, while of human origin, can be useful for heterologous expression of mouse Selenoprotein S when high transfection efficiency is needed . These cells are particularly suitable for protein-protein interaction studies, such as investigating Selenoprotein S binding to p97(VCP) and other ERAD components.

Primary mouse B lymphocytes represent a physiologically relevant model for studying Selenoprotein S in immune function, given the significant impact of selenoprotein deficiency on B-cell development observed in mouse models . These cells can be isolated from mouse spleen or bone marrow and maintained in culture for short-term experiments.

Mouse embryonic stem cells (mESCs) differentiated into various lineages can model the role of Selenoprotein S in development and cell fate decisions. This approach is particularly valuable given the lineage-specific effects of selenoprotein deficiency .

Bone marrow-derived hematopoietic stem cells (HSCs) provide insights into the role of Selenoprotein S in stem cell maintenance and differentiation, especially considering the impaired self-renewal capacity observed in selenoprotein-deficient HSCs .

Immortalized mouse embryonic fibroblasts (MEFs) offer a robust model for studying basic cellular functions of Selenoprotein S and generating stable knockout or knockdown cell lines using CRISPR-Cas9 or shRNA approaches.

When selecting a cell culture model, researchers should consider several factors: the endogenous expression level of Selenoprotein S, the cellular context most relevant to their research question, the ease of genetic manipulation, and the specific readouts or assays they plan to employ.

What techniques are most effective for studying Selenoprotein S-protein interactions?

Multiple complementary techniques can be employed to comprehensively characterize the interaction partners of mouse Selenoprotein S:

Co-immunoprecipitation (Co-IP) followed by western blotting or mass spectrometry remains a cornerstone technique for identifying stable protein interactions. This approach has been used to study selenoprotein interactions with partners like p97(VCP) . When applying this technique to Selenoprotein S, careful optimization of detergent conditions is essential due to its transmembrane nature.

Proximity-based labeling methods such as BioID or APEX2 offer powerful alternatives for capturing both stable and transient interactions in living cells. By fusing a biotin ligase or peroxidase to Selenoprotein S, researchers can biotinylate proteins in close proximity, which can then be purified using streptavidin and identified by mass spectrometry.

Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) provides spatial information about protein interactions in living cells. These approaches are particularly valuable for visualizing the dynamics of Selenoprotein S interactions in response to stress conditions or pharmacological interventions.

Crosslinking mass spectrometry (XL-MS) can identify specific interaction interfaces between Selenoprotein S and its binding partners by covalently linking proteins in close proximity before mass spectrometric analysis. This technique provides structural insights that complement other interaction data.

Pull-down assays using recombinant fragments of Selenoprotein S can map specific domains involved in protein interactions. For example, the N-terminal cytosolic domain could be expressed as a GST-fusion protein and used to identify cytosolic interaction partners.

Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine the binding affinity and kinetics of Selenoprotein S interactions with purified proteins, providing quantitative parameters that characterize these interactions.

Yeast two-hybrid screening, while challenging for transmembrane proteins like Selenoprotein S, can be adapted using split-ubiquitin systems specifically designed for membrane proteins to identify novel interaction partners in an unbiased manner.

How can CRISPR-Cas9 be utilized to study mouse Selenoprotein S function?

CRISPR-Cas9 technology offers versatile approaches for investigating mouse Selenoprotein S function through precise genetic modifications:

Complete knockout of Selenoprotein S can be achieved by designing guide RNAs targeting early exons of the gene, introducing frameshift mutations that prevent functional protein expression. This approach is particularly useful for identifying essential functions, similar to the selenocysteine tRNA gene (Trsp) knockout approach used to study selenoprotein functions broadly .

For studying the importance of specific domains or residues, precise point mutations can be introduced using CRISPR-Cas9 with a repair template. For example, the selenocysteine codon can be mutated to a cysteine codon to assess the importance of the selenol group for Selenoprotein S function.

Endogenous tagging of Selenoprotein S can be accomplished by inserting sequences encoding epitope tags (FLAG, HA) or fluorescent proteins (GFP, mCherry) at the N-terminus or within non-essential regions. This allows visualization of the native protein's localization and facilitates immunoprecipitation of endogenous complexes.

Conditional knockout systems using loxP sites flanking critical exons, combined with tissue-specific Cre recombinase expression (similar to the Mx1-Cre system used in search result ), enable temporal and spatial control over Selenoprotein S deletion. This approach is particularly valuable when complete knockout might be lethal.

CRISPR interference (CRISPRi) or CRISPR activation (CRISPRa) systems, using catalytically inactive Cas9 fused to transcriptional repressors or activators, allow modulation of Selenoprotein S expression levels without altering the genomic sequence. This approach offers a more nuanced alternative to complete knockout.

Pooled CRISPR screens targeting genes across the genome in Selenoprotein S knockout or overexpression backgrounds can identify genetic interactions and pathways that buffer or enhance Selenoprotein S function. This approach could reveal synthetic lethal interactions or compensatory mechanisms.

When designing CRISPR experiments for Selenoprotein S, researchers should carefully consider potential off-target effects, validate modifications by sequencing, and include appropriate controls such as rescue experiments with wild-type Selenoprotein S to confirm phenotype specificity.

How should researchers interpret changes in Selenoprotein S expression levels under different experimental conditions?

Interpreting changes in mouse Selenoprotein S expression requires careful consideration of multiple factors that influence expression patterns and their functional significance:

Experimental ConditionTypical Expression ChangePotential MechanismsFunctional Implications
ER stress (tunicamycin, thapsigargin) UpregulationUPR activation, ERSE elements in promoterEnhanced ERAD capacity to clear misfolded proteins
Oxidative stressUpregulationNRF2 pathway activation , antioxidant responseProtection against lipid peroxidation and ferroptosis
Inflammatory stimuliVariable (context-dependent)NF-κB signaling, cytokine feedbackModulation of inflammatory responses
Selenium deficiencyDownregulationNonsense-mediated decay of mRNA Compromised ER stress and oxidative stress responses
AgingTypically downregulatedObserved downregulation of selenoprotein mRNAs in aged HSCs Contributes to age-related stress vulnerability

When analyzing expression data, several methodological considerations are critical:

Distinguish between mRNA and protein-level changes, as these may not always correlate. Selenoprotein synthesis involves unique translational mechanisms dependent on selenium availability and SECIS element function , which can lead to discrepancies between transcription and translation.

Consider the specificity of detection methods. For Western blotting, verify antibody specificity using knockout controls. For qPCR, design primers that distinguish between potential splice variants or isoforms with different transcription start sites .

The cellular context significantly impacts Selenoprotein S expression and function. Search result emphasizes that "cell context and lineage dictate sensitivity to selenoprotein synthesis defects," indicating that expression changes may have different implications in different cell types.

Expression changes should be interpreted in relation to functional outcomes. Changes in Selenoprotein S expression might affect cellular responses to ER stress, sensitivity to oxidative damage, or immune signaling pathways, depending on the cell type and context.

How can researchers distinguish between direct and indirect effects of Selenoprotein S manipulation?

Distinguishing between direct and indirect effects of mouse Selenoprotein S manipulation requires a multi-faceted experimental approach:

Temporal analysis provides crucial insights, as direct effects typically manifest more rapidly than indirect ones. Time-course experiments following acute Selenoprotein S manipulation can help separate immediate consequences (likely direct) from delayed responses (potentially indirect). This approach is particularly valuable for studying stress responses that involve complex signaling cascades.

Structure-function analysis using domain-specific mutations or selenocysteine-to-cysteine substitutions can identify which aspects of Selenoprotein S are responsible for particular phenotypes. If a specific mutation abolishes a particular effect without affecting others, that effect likely depends directly on the mutated feature.

Interaction studies using techniques like co-immunoprecipitation or proximity labeling can establish direct physical interactions between Selenoprotein S and other proteins or cellular components. The Selenoprotein S-dependent binding of selenoprotein K to p97(VCP) mentioned in search result represents an example of such direct interaction analysis.

Rescue experiments provide compelling evidence for direct effects. If reintroduction of wild-type Selenoprotein S into knockout models reverses a phenotype, that phenotype likely results directly from Selenoprotein S deficiency rather than from secondary adaptations.

Parallel manipulation of potential mediators can test specific pathways. If blocking a proposed downstream mediator prevents the effect of Selenoprotein S manipulation, this suggests an indirect mechanism involving that mediator. For example, if Selenoprotein S effects are mediated through NRF2 activation , NRF2 inhibition should block those effects.

Unbiased omics approaches like RNA-seq, proteomics, or metabolomics at early time points following Selenoprotein S manipulation can identify the earliest molecular changes, which are more likely to represent direct effects. Search result describes RNA-seq and single-cell RNA-seq approaches that could be adapted for this purpose.

What statistical approaches are most appropriate for analyzing Selenoprotein S experimental data?

Selecting appropriate statistical approaches for mouse Selenoprotein S research depends on the experimental design and the nature of the data being analyzed:

For comparing expression levels or functional parameters between two groups (e.g., wild-type vs. Selenoprotein S knockout), Student's t-test is appropriate if data meet assumptions of normality and equal variance. Non-parametric alternatives such as the Mann-Whitney U test should be used when these assumptions are not met.

For experiments involving multiple groups or conditions, analysis of variance (ANOVA) followed by appropriate post-hoc tests (Tukey's, Bonferroni, or Dunnett's) should be employed to control the family-wise error rate. This approach is particularly important when comparing multiple mutants or treatment conditions.

For time-course experiments or repeated measurements, repeated measures ANOVA or mixed-effects models provide greater statistical power by accounting for within-subject correlations. These approaches are valuable for studying dynamic responses to stress conditions or treatment interventions.

For complex datasets such as the RNA-seq and single-cell RNA-seq data described in search result , specialized analytical pipelines are required. Differential expression analysis typically employs packages like DESeq2 or edgeR, while single-cell data analysis might use Seurat or Scanpy for clustering and trajectory inference.

Gene set enrichment analysis (GSEA) or pathway analysis can identify coordinated changes in functionally related gene sets, as demonstrated in search result where GSEA revealed enrichment for aging-related genes and NRF2 pathway activation in selenoprotein-deficient cells.

Correlation analyses can establish relationships between Selenoprotein S expression levels and functional parameters or other molecular markers. Pearson's correlation is appropriate for normally distributed data, while Spearman's rank correlation is more robust to outliers and non-linear relationships.

For all statistical analyses, researchers should report not just p-values but also effect sizes and confidence intervals to provide a complete picture of the magnitude and precision of the observed effects. Power analysis should be conducted a priori to ensure studies are adequately powered to detect biologically meaningful differences.

What are the common pitfalls in interpreting phenotypes of Selenoprotein S knockout models?

Interpreting phenotypes of mouse Selenoprotein S knockout models presents several challenges that researchers must navigate carefully:

Compensatory mechanisms often emerge in knockout models, potentially masking the full impact of Selenoprotein S deficiency. Search result notes that "NRF2 compensates for impaired ROS scavenging in HSPCs" when selenoprotein synthesis is disrupted. This adaptation highlights the importance of examining both acute and chronic effects of Selenoprotein S loss.

Developmental effects of Selenoprotein S knockout may complicate phenotypic analysis, as defects observed in adult animals could result from developmental abnormalities rather than from the ongoing absence of Selenoprotein S function. Conditional knockout models using inducible systems can help distinguish between these possibilities.

Cell type-specific effects can be easily overlooked in whole-organism or whole-tissue analyses. Search result emphasizes that "cell context and lineage dictate sensitivity to selenoprotein synthesis defects," with B lymphocytes being particularly affected while myeloid cells showed minimal impact. Single-cell approaches may be necessary to fully capture this heterogeneity.

Indirect effects mediated through altered selenium metabolism represent another challenge, as Selenoprotein S knockout could alter selenium availability for other selenoproteins. This possibility should be considered when interpreting phenotypes that resemble those of other selenoprotein deficiencies.

Technical variables such as the targeting strategy used to create the knockout, the genetic background of the mice, and environmental factors like selenium content in the diet can all influence phenotypic outcomes. These variables should be carefully controlled and reported.

The dual roles of Selenoprotein S in ER stress response and redox regulation can make it difficult to determine which function is responsible for specific phenotypes. Complementary approaches using point mutations that selectively affect one function while preserving the other can help resolve this ambiguity.

How can researchers correlate in vitro findings about Selenoprotein S with in vivo physiological relevance?

Bridging the gap between in vitro observations and in vivo physiological relevance for mouse Selenoprotein S research requires strategic experimental approaches:

Use physiologically relevant cell models that reflect the in vivo cellular context. For example, primary B lymphocytes or hematopoietic stem cells may better capture the physiological roles of Selenoprotein S in these lineages compared to immortalized cell lines, particularly given the lineage-specific effects observed in knockout models .

Validate key findings across multiple experimental systems. Observations made in cell lines should be confirmed in primary cells, organoids, or tissue explants before progressing to in vivo models. This multi-tiered validation approach strengthens confidence in the physiological relevance of the findings.

Employ parallel readouts in in vitro and in vivo systems. If studying ER stress responses in cultured cells, assess the same molecular markers (e.g., XBP1 splicing, BiP induction) in tissues from mouse models. This approach, exemplified in search result where similar molecular analyses were performed in cell culture and animal models, facilitates direct comparisons between systems.

Consider physiological stress conditions rather than artificial stressors. While treatments like tunicamycin are valuable for mechanistic studies, complementing these with more physiological stressors (e.g., glucose deprivation, hypoxia) can enhance translational relevance.

Use tissue-specific or inducible knockout models to mirror in vitro manipulations. The Mx1-Cre system mentioned in search result provides temporal control over gene deletion, allowing researchers to distinguish acute effects from adaptive responses and better align with in vitro acute knockdown or inhibition experiments.

Perform rescue experiments both in vitro and in vivo using the same Selenoprotein S variants. If a specific mutation abolishes function in cultured cells, expressing the same mutant in knockout mice should fail to rescue the in vivo phenotype if the mechanism is conserved.

Correlate findings with human data whenever possible. Although the query focuses on mouse Selenoprotein S, connecting mouse findings to human selenoprotein functions, as done in search result comparing mouse phenotypes to aged human HSCs, strengthens the translational potential of the research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.