Recombinant Mouse Serine palmitoyltransferase small subunit B (Sptssb)

Shipped with Ice Packs
In Stock

Description

Functional Roles in the SPT Complex

Sptssb partners with large subunits (SPTLC1 and SPTLC2/3) to form the SPT holoenzyme, which converts serine and acyl-CoA into sphinganine (a precursor for sphingolipids). Key functions include:

  • Substrate Preference Regulation:

    • SPTLC1-SPTLC2-Sptssb: Strong preference for C18-CoA substrates .

    • SPTLC1-SPTLC3-Sptssb: Broad substrate utilization (C16-C18-CoA) .

  • Enzyme Activity Modulation: Sptssb stimulates SPT activity and determines acyl-CoA specificity .

Neurodegeneration Linked to Sptssb Mutation

A murine Stellar (Stl) mutation in Sptssb increased SPT affinity for C18-CoA, elevating 20-carbon long-chain bases (C20-LCBs) in the brain and eye. This led to:

  • Aberrant Membrane Structures

  • Accumulation of Ubiquitinated Proteins

  • Axon Degeneration .

PhenotypeMechanismSource
C20-LCB ElevationAltered SPT substrate affinity due to Stl mutation
NeurodegenerationDisrupted protein homeostasis and membrane integrity

This study underscores Sptssb’s role in maintaining sphingolipid chain length homeostasis .

Experimental Tools

ApplicationDescriptionSource
ELISA AssaysQuantification of Sptssb levels using recombinant protein standards .
shRNA SilencingAAV-delivered shRNA for gene knockdown in functional genomics studies .
Recombinant ProteinsUsed in enzymatic assays to study SPT activity and substrate specificity .

Biological Contexts

  • Prostate Tissue: Sptssb expression is repressed by androgens in castrated mice but restored in hypogonadal models .

  • Sphingolipid Metabolism: Sptssb modulates the balance between C18- and C20-LCBs, influencing membrane composition and cellular signaling .

Table 1: Recombinant Sptssb Properties

ParameterValue
Host SystemHEK293T, E. coli, yeast, or in vitro cell-free systems
TagMYC/DDK, GST, His (varies by product)
Purity>80% (SDS-PAGE) , >85% (Cell Free)
Concentration>50 μg/mL (BCA method)

Table 2: Research Implications of Sptssb Mutations

ObservationBiological Impact
C20-LCB AccumulationAxon degeneration, protein aggregation, and membrane dysfunction .
Substrate PreferenceShift from C18- to C20-CoA in Stl mutants .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Your specified tag type, if any, will be prioritized during production. Please communicate your requirements accordingly.
Synonyms
Sptssb; Admp; Sssptb; Serine palmitoyltransferase small subunit B; Protein ADMP; Small subunit of serine palmitoyltransferase B; ssSPTb
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-76
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Sptssb
Target Protein Sequence
MDFKRVKEYFAWLYYQYQIITCCAVMEPWEQSMLNTIILTIVAMVVYTAYVFIPIHIRLA WEFFSKICGYDSSISN
Uniprot No.

Target Background

Function

This recombinant mouse Serine palmitoyltransferase small subunit B (Sptssb) stimulates serine palmitoyltransferase (SPT) activity. The SPT complex composition dictates substrate preference; complexes containing this subunit exhibit a preference for longer acyl-CoAs. The SPTLC1-SPTLC2-SPTSSB complex strongly prefers C18-CoA, while the SPTLC1-SPTLC3-SPTSSB isozyme utilizes a broader range of acyl-CoAs without a clear preference.

Gene References Into Functions
  1. Androgen down-regulated gene in mouse prostate (ADMP) expression shows androgen-dependence in the kidney and brain of normal mice, suggesting tissue-specific androgen regulation. PMID: 15777716
Database Links
Protein Families
SPTSS family, SPTSSB subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Expression is strong in hypogonadal (hpg) mouse prostate, weak in mature castrated mouse prostate and absent in normal intact or androgen-replaced hpg mouse prostates.

Q&A

What is Serine Palmitoyltransferase Small Subunit B (Sptssb) and what is its function?

Sptssb is a small regulatory subunit of the serine palmitoyltransferase (SPT) enzyme complex, which catalyzes the first committed and rate-limiting step in sphingolipid biosynthesis. The SPT enzyme complex typically consists of two large subunits (SPTLC1 and either SPTLC2 or SPTLC3) and a small subunit (either SPTSSA or SPTSSB). Specifically, Sptssb stimulates SPT activity and influences the acyl-CoA substrate preference of the catalytic heterodimer .

When Sptssb associates with the core SPT complex, it modulates enzyme activity and substrate specificity, particularly affecting the chain length determination of sphingoid long chain bases (LCBs). Research has demonstrated that Sptssb plays a critical role in determining whether the enzyme produces typical 18-carbon sphingoid bases or longer 20-carbon variants .

What is the structural composition of recombinant mouse Sptssb?

Recombinant mouse Sptssb is a small protein (~80 amino acids in length), similar to its human ortholog which spans approximately 76 amino acids . The protein contains a characteristic "Small subunit of serine palmitoyltransferase-like" domain (IPR024512) . When produced recombinantly, mouse Sptssb is typically expressed in mammalian cell systems such as HEK-293 cells to ensure proper folding and post-translational modifications .

The recombinant protein is often tagged for purification and detection purposes, with common tags including Myc-DYKDDDDK (Flag) or Fc tags positioned at either the N- or C-terminus . The purified protein typically exhibits >90% purity when analyzed by SDS-PAGE, Western blot, or analytical SEC (HPLC) .

Where is Sptssb localized within cells and how does this affect its function?

Sptssb is primarily localized to the endoplasmic reticulum (ER) membrane where it forms part of the serine palmitoyltransferase complex . This localization is consistent with the ER being the primary site of sphingolipid biosynthesis. The membrane association of Sptssb is critical for its function, as it places the protein in proximity to both its catalytic partners (SPTLC1/SPTLC2/SPTLC3) and the substrates required for sphingolipid synthesis .

The ER localization also positions Sptssb to participate in ER organization processes, as predicted by functional annotations in model organisms like zebrafish . This spatial organization is essential for coordinating sphingolipid biosynthesis with other cellular processes and maintaining proper membrane homeostasis.

What are the optimal expression systems for producing recombinant mouse Sptssb protein?

For producing functional recombinant mouse Sptssb protein, mammalian expression systems are generally preferred over prokaryotic systems. HEK-293 cells have proven particularly effective, as demonstrated in multiple studies . These cells provide the appropriate cellular machinery for post-translational modifications and proper protein folding that may be critical for Sptssb functionality.

Methodology:

  • Clone the full-length mouse Sptssb cDNA (coding for amino acids 1-80) into a mammalian expression vector containing an appropriate tag (e.g., Myc-DYKDDDDK or Fc tag).

  • Transfect HEK-293 cells using a high-efficiency transfection method such as calcium phosphate precipitation or lipid-based transfection.

  • Culture cells for 48-72 hours post-transfection to allow protein expression.

  • Harvest cells and lyse using a buffer containing 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol, supplemented with protease inhibitors.

  • Purify the tagged protein using affinity chromatography appropriate for the chosen tag.

  • Assess protein purity using SDS-PAGE with Coomassie blue staining (should achieve >80% purity) and confirm identity with Western blotting .

What methods are most effective for studying Sptssb-mediated regulation of sphingolipid synthesis?

Studying Sptssb-mediated regulation of sphingolipid synthesis requires a combination of molecular biology, biochemistry, and analytical techniques:

  • Gene Expression Analysis: Quantitative RT-PCR to measure Sptssb mRNA levels in different tissues or under various treatment conditions. This approach has been used to demonstrate that androgen receptor signaling negatively regulates Sptssb expression in prostate cancer cell lines .

  • Isotope Labeling: Incorporate isotope-labeled serine (a necessary amino acid for sphingolipid synthesis) into cell culture media to trace newly synthesized sphingolipids. This technique has been successfully used to demonstrate increased de novo sphingolipid synthesis following androgen receptor inhibition .

  • Mass Spectrometry: Liquid chromatography-tandem mass spectrometry (LC-MS/MS) is the gold standard for quantifying different sphingolipid species, including long chain bases of varying carbon chain lengths. This approach allows researchers to determine how modulation of Sptssb affects the sphingolipid profile .

  • In Vitro Enzyme Assays: Reconstitute the SPT complex with recombinant SPTLC1, SPTLC2/SPTLC3, and Sptssb to measure enzyme kinetics, substrate preferences, and the effect of Sptssb on catalytic activity. Typically, this involves measuring the condensation of serine with palmitoyl-CoA to form 3-ketodihydrosphingosine .

How can researchers effectively generate and validate Sptssb knockout or mutant models?

Several approaches can be employed to generate and validate Sptssb knockout or mutant models:

For Cell Culture Models:

  • CRISPR/Cas9 gene editing: Design guide RNAs targeting exonic regions of Sptssb and screen clones for frameshift mutations.

  • shRNA or siRNA knockdown: For transient reduction of Sptssb expression.

  • Validation: Confirm knockdown/knockout by qRT-PCR and Western blotting. Functional validation should include sphingolipid profiling by mass spectrometry, particularly measuring changes in C18 versus C20 long chain bases .

For Mouse Models:

  • Conventional knockout: Remove critical exons from the Sptssb gene.

  • Point mutations: Introduce specific mutations identified in human disease or that alter enzyme function, such as the Stellar (Stl) mutation that increases SPT affinity for C18 fatty acyl-CoA and elevates C20 LCB production .

  • Validation: Confirm genotype by PCR and expression changes by qRT-PCR and Western blotting. Phenotypic analysis should include neurological assessment, as Sptssb mutations have been linked to neurodegenerative effects including aberrant membrane structures, protein aggregation, and axon degeneration .

How does Sptssb influence sphingolipid long chain base (LCB) composition and what are the methodological approaches to study this effect?

Sptssb plays a critical role in determining sphingolipid LCB composition, particularly influencing the production of 20-carbon (C20) versus the typical 18-carbon (C18) LCB species. The Stellar (Stl) mutation in Sptssb has been shown to increase the SPT complex's affinity toward C18 fatty acyl-CoA substrate by approximately twofold, resulting in elevated C20 LCB production in mouse brain and eye tissues .

Methodological approaches to study this effect include:

  • Lipidomic Analysis: Using liquid chromatography coupled with high-resolution mass spectrometry (LC-MS) to quantify the different LCB species. This typically involves:

    • Lipid extraction from tissues or cells using modified Bligh-Dyer methodology

    • Separation on a C18 reverse phase column

    • Multiple reaction monitoring (MRM) for targeted quantification of specific LCB species

    • Internal standards for absolute quantification

  • In Vitro Enzymatic Assays: Reconstituting the SPT complex with wild-type or mutant Sptssb and measuring:

    • Enzyme kinetics with different acyl-CoA substrates (C16, C18, C20)

    • Substrate affinity (Km) and maximum reaction velocity (Vmax)

    • Product formation using radioisotope-labeled substrates or mass spectrometry

  • Stable Isotope Labeling:

    • Incorporate 13C-labeled serine or fatty acids into cell culture media

    • Track the incorporation into different LCB species over time

    • Determine the flux through different branches of the sphingolipid biosynthetic pathway

The table below summarizes typical changes in LCB composition observed with Sptssb mutation:

LCB SpeciesWild-typeSptssb Stellar MutationFold Change
C18 dihydrosphingosine+++++↓ 0.7x
C20 dihydrosphingosine++++↑ 3-5x
C18 sphingosine+++++↓ 0.8x
C20 sphingosine++++↑ 2-4x

What is the relationship between Sptssb expression and neurodegeneration, and how can it be investigated experimentally?

Research has established a connection between Sptssb mutations and neurodegenerative effects. The Stellar (Stl) mutation in Sptssb increases production of C20 LCBs, which appears to impair protein homeostasis and neural functions. Neurodegenerative effects include aberrant membrane structures, accumulation of ubiquitinated proteins on membranes, and axon degeneration .

Experimental approaches to investigate this relationship:

  • Histological and Ultrastructural Analysis:

    • Electron microscopy to examine membrane structure abnormalities

    • Immunohistochemistry to detect protein aggregation and ubiquitination

    • Axonal staining to assess neuronal integrity and degeneration

  • Protein Homeostasis Assessment:

    • Ubiquitin-proteasome system activity assays

    • Autophagy flux monitoring

    • Protein aggregation quantification using filter trap assays or fluorescent reporters

  • Functional Studies:

    • Electrophysiological recordings to assess neural activity

    • Behavioral tests to evaluate sensory, motor, and cognitive functions

    • In vivo imaging of neuronal structure and function

  • Rescue Experiments:

    • Sphingolipid pathway inhibitors to normalize LCB composition

    • Protein homeostasis enhancers to counteract proteopathy

    • Gene therapy approaches to restore normal Sptssb function

A comprehensive experimental design would include age-dependent analysis, tissue-specific effects (brain regions most affected), and correlation between sphingolipid alterations and phenotypic severity.

How does Sptssb contribute to cancer biology, particularly in the context of androgen receptor signaling in prostate cancer?

Recent research has uncovered interesting connections between Sptssb, sphingolipid metabolism, and prostate cancer (PCa) treatment response. Androgen receptor (AR) signaling appears to negatively regulate Sptssb expression, which in turn affects de novo sphingolipid synthesis and sensitivity to ceramide nanoliposomes (CNLs) .

Key findings and experimental approaches:

  • Expression Regulation:

    • AR stimulation with R1881 (an AR agonist) significantly decreases Sptssb expression in AR-positive prostate cancer cell lines

    • Conversely, AR inhibition with abiraterone (Abi) increases Sptssb expression by nearly 2-fold

    • This regulation can be studied using qRT-PCR and Western blot analysis after hormone or anti-androgen treatment

  • Functional Impact on De Novo Sphingolipid Synthesis:

    • AR inhibition increases de novo sphingolipid synthesis

    • This can be measured using isotope-labeled serine and mass spectrometry

    • Higher Sptssb expression correlates with increased dihydrosphingosine production

  • Therapeutic Implications:

    • AR-positive cells have limited sensitivity to ceramide nanoliposomes (CNLs)

    • Combining anti-androgens with CNLs enhances therapeutic efficacy

    • Sptssb knockdown reduces CNL efficacy in AR-negative cells

    • These effects can be studied using cell viability assays, apoptosis measurements, and in vivo tumor models

The table below summarizes the relationships between AR status, Sptssb expression, and CNL sensitivity:

AR StatusSptssb ExpressionDe Novo Sphingolipid SynthesisCNL SensitivityTherapeutic Approach
AR+LowLowLimitedCombine AR inhibitors with CNL
AR-HighHighHighCNL monotherapy
AR+ with AR inhibitionIncreasedIncreasedEnhancedCombined therapy

What are common challenges in producing and maintaining stable recombinant Sptssb protein, and how can these be addressed?

Researchers commonly encounter several challenges when working with recombinant Sptssb:

  • Protein Instability: Sptssb is a small protein (~80 amino acids) that may be prone to degradation.

    • Solution: Store at -80°C in buffer containing 25 mM Tris-HCl (pH 7.3), 100 mM glycine, and 10% glycerol

    • Limit freeze-thaw cycles to 2-3 maximum

    • Aliquot to single-use tubes immediately after thawing

  • Low Expression Yield: As a small regulatory protein, expression yields may be limited.

    • Solution: Optimize codon usage for the expression system

    • Use strong promoters suitable for mammalian expression

    • Consider fusion partners that can enhance expression and solubility

  • Maintaining Native Conformation: Ensuring the recombinant protein maintains its natural interaction capacity with SPT complex components.

    • Solution: Express in mammalian systems like HEK-293 cells rather than bacterial systems

    • Verify functional activity through in vitro reconstitution assays with SPTLC1/SPTLC2

    • Consider native purification conditions that preserve protein-protein interactions

  • Tag Interference: Purification tags may interfere with protein function.

    • Solution: Compare N-terminal versus C-terminal tag placement

    • Include cleavable tags and compare protein activity before and after tag removal

    • Validate through functional assays that the tagged protein behaves similar to the native form

How can researchers address data inconsistencies in Sptssb functional studies across different experimental systems?

When studying Sptssb function, researchers may encounter inconsistencies across experimental systems. These can be addressed through:

  • Standardization of Experimental Conditions:

    • Use consistent cell lines, expression systems, and assay conditions

    • Standardize protein concentrations and substrate ratios in enzymatic assays

    • Document detailed protocols including buffer compositions, incubation times, and temperatures

  • Comprehensive Controls:

    • Include both positive and negative controls in each experiment

    • Use multiple experimental approaches to validate findings

    • Compare Sptssb with Sptssa to distinguish small subunit-specific effects

  • Accounting for Species Differences:

    • Human and mouse Sptssb share high homology but may have subtle functional differences

    • Compare recombinant proteins from different species side-by-side

    • Consider using species-matched components when reconstituting the SPT complex

  • Addressing Technical Variability in Sphingolipid Analysis:

    • Use internal standards for all sphingolipid species being measured

    • Implement rigorous quality control procedures for mass spectrometry

    • Pool biological replicates for technical analysis to reduce variability

  • Validation Across Models:

    • Confirm cell culture findings in animal models when possible

    • Compare results from overexpression, knockdown, and mutation approaches

    • Correlate findings with human patient data where available

What are emerging areas of Sptssb research that require further investigation?

Several promising research directions for Sptssb warrant further investigation:

  • Structure-Function Relationships: Despite its importance in regulating sphingolipid synthesis, the three-dimensional structure of Sptssb and its interaction with SPT large subunits remains poorly characterized. Structural biology approaches including X-ray crystallography and cryo-electron microscopy of the entire SPT complex would greatly advance our understanding of how Sptssb regulates enzyme activity and substrate specificity.

  • Tissue-Specific Functions: Current research has focused primarily on Sptssb in the brain and cancer cells, but its role in other tissues remains largely unexplored. Tissue-specific knockout models could reveal unique functions in different physiological contexts.

  • Regulation of Sptssb Expression: While androgen receptor signaling has been shown to regulate Sptssb expression in prostate cancer cells , the broader transcriptional and post-transcriptional regulation of Sptssb across different tissues and disease states warrants further investigation.

  • Therapeutic Targeting: Given its role in sphingolipid metabolism and connections to both neurodegeneration and cancer, Sptssb represents a potential therapeutic target. Developing specific modulators of Sptssb function could have applications in treating both neurodegenerative disorders and cancer.

  • Interaction with Other Sphingolipid Metabolic Enzymes: Research into how Sptssb coordinates with downstream enzymes in the sphingolipid pathway could reveal broader metabolic networks and regulatory mechanisms.

How might advances in structural biology and proteomics enhance our understanding of Sptssb function?

Advanced structural and proteomic approaches offer significant potential for elucidating Sptssb function:

  • Cryo-EM for Complex Structure Determination:

    • Visualization of the entire SPT complex with bound Sptssb

    • Mapping conformational changes induced by Sptssb binding

    • Comparison of complexes with Sptssa versus Sptssb to understand subunit-specific effects

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Probing dynamic protein-protein interactions between Sptssb and SPTLC subunits

    • Identifying regions of conformational change upon substrate binding

    • Mapping differences between wild-type and mutant Sptssb

  • Crosslinking Mass Spectrometry (XL-MS):

    • Identification of specific interaction points between Sptssb and other SPT components

    • Mapping the spatial proximity of different regions within the complex

    • Understanding how mutations alter these interactions

  • Interactome Analysis:

    • Proximity labeling techniques (BioID, APEX) to identify novel Sptssb interactors

    • Quantitative proteomics to determine how Sptssb affects the broader sphingolipid synthesis machinery

    • Identifying tissue-specific interaction partners that may confer specialized functions

  • Post-Translational Modification Mapping:

    • Identification of regulatory phosphorylation, ubiquitination, or other modifications on Sptssb

    • Understanding how these modifications affect Sptssb stability, localization, and function

    • Determining the enzymes responsible for these modifications as potential regulatory nodes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.