Recombinant Mouse Serine protease HTRA2, mitochondrial (Htra2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Serine Protease HTRA2, Mitochondrial (Htra2)

Recombinant Mouse Serine Protease HTRA2, mitochondrial (HtrA2), is a serine protease within the HtrA family, which is evolutionarily conserved across species from prokaryotes to humans . HtrA2 is located in the intermembrane space (IMS) of mitochondria and functions in mitochondrial quality control . It is involved in various cellular networks and pathophysiological functions .

Role in Mitochondrial Quality Control

HtrA2 plays a critical role in mitochondrial quality control by :

  • Degrading misfolded proteins: Similar to bacterial proteases DegP and DegS, HtrA2 degrades misfolded and damaged proteins in the mitochondria . Studies show increased accumulation of unfolded subunits of respiratory complexes I–IV in mitochondria from HtrA2 knockout mice, leading to generalized respiratory chain dysfunction .

  • Maintaining mitochondrial homeostasis: HtrA2 is essential for mitochondrial homeostasis, and its loss leads to mitochondrial dysfunction and increased sensitivity to stress-induced cell death .

Impact on Cellular Stress Response

Research indicates that loss of HtrA2 function leads to increased sensitivity to mitochondrial stress :

  • Enhanced CHOP Expression: HtrA2 knockout cells show increased sensitivity to mitochondrial stress, characterized by enhanced expression of CHOP, a transcription factor induced by various stresses .

  • Upregulation of ISR Genes: Loss of HtrA2 results in transcriptional upregulation of nuclear genes characteristic of the integrated stress response (ISR) .

  • Respiratory Dysfunction: Absence of HtrA2 results in a generalized respiratory dysfunction, leading to excessive production of reactive oxygen species (ROS) and accumulation of oxidative damage, including damage to mitochondrial membrane lipids .

Involvement in Diseases

Mutations and functional changes in HtrA2 are associated with several diseases:

  • Neurodegenerative Disorders: A missense mutation (Ser276Cys) in HtrA2 in transgenic mice leads to motor neuron degeneration .

  • Parkinson's Disease: A novel variant Pro143Ala in HTRA2 contributes to Parkinson's disease by inducing hyperphosphorylation of the HTRA2 protein in mitochondria .

  • Early-Onset Mitochondrial Syndrome: Pathogenic variants in HTRA2 cause an early-onset mitochondrial syndrome associated with 3-methylglutaconic aciduria, seizures, neutropenia, hypotonia, and cardio-respiratory problems .

  • Mitochondrial dysfunction: Dysfunction in HtrA2 has been linked to increased levels of pSTAT3, potentially improving rheumatoid arthritis (RA) by inhibiting STAT3 .

Data Tables

The following tables summarize key research findings related to HtrA2.

Table 1: HtrA2 and Mitochondrial Stress Response

FeatureObservationReference
HtrA2 Knockout CellsIncreased sensitivity to mitochondrial stress
CHOP ExpressionEnhanced expression in HtrA2-deficient cells
ISR GenesTranscriptional upregulation in response to HtrA2 loss
Mitochondrial RespirationGeneralized respiratory dysfunction in the absence of HtrA2
Oxidative DamageExcessive ROS production and accumulation of oxidative damage

Table 2: HtrA2 Mutations and Associated Diseases

Mutation/DysfunctionAssociated Disease/ConditionReference
Ser276CysMotor neuron degeneration in transgenic mice
Pro143AlaParkinson's Disease (via hyperphosphorylation of HTRA2 protein)
Pathogenic variantsEarly-onset mitochondrial syndrome with 3-methylglutaconic aciduria, seizures, neutropenia, hypotonia, etc.
Increased pSTAT3Rheumatoid Arthritis (potential improvement via STAT3 inhibition)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Dry ice shipments incur additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Htra2; Omi; Prss25; Serine protease HTRA2, mitochondrial; High temperature requirement protein A2; HtrA2; Omi stress-regulated endoprotease; Serine protease 25; Serine proteinase OMI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
134-458
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
AVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPISNGSGFVVASDGLI VTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQ GEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQNNVEYIQTDAAIDFGNSGGPLVNL DGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGTSGSQRRYIGVMMLTLTPSI LIELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEKLAQNAEDVYEAVRT QSQLAVRIRRGSETLTLYVTPEVTE
Uniprot No.

Target Background

Function
Recombinant Mouse Serine protease HTRA2, mitochondrial (Htra2) is a serine protease exhibiting non-specific proteolytic activity against beta-casein. It induces cell death through two mechanisms: 1) direct binding and inhibition of BIRC proteins (Inhibitor of Apoptosis Proteins, IAPs), resulting in increased caspase activity; and 2) a BIRC-independent, caspase-independent mechanism dependent on serine protease activity. It also cleaves and promotes the degradation of THAP5 during apoptosis.
Gene References Into Functions
  1. Overexpression of mitochondrial Omi/HtrA2 induces cardiac apoptosis and dysfunction. PMID: 27924873
  2. Mice overexpressing wild-type or G399S mutant HtrA2 exhibit mitochondrial defects leading to neurodegeneration. PMID: 26604148
  3. Omi facilitates neurite outgrowth by cleaving the transcription factor E2F1 in differentiated neuroblastoma cells. PMID: 26238290
  4. The NG2 proteoglycan protects oligodendrocyte precursor cells from oxidative stress via interaction with OMI/HtrA2. PMID: 26340347
  5. Loss of Omi protease activity leads to increased GSK3b, resulting in PGC-1α degradation, impaired mitochondrial biogenesis, and neurodegeneration. PMID: 25118933
  6. Neural-specific deletion of Htra2 causes cerebellar neurodegeneration and defective processing of mitochondrial OPA1. PMID: 25531304
  7. Radiation-inducible gene therapy shows potential for uveal melanoma treatment due to spatial and temporal control by exogenous radiation. PMID: 24606398
  8. Inactivation of Omi/HtrA2 deregulates mitochondrial Mulan E3 ubiquitin ligase and increases mitophagy. PMID: 24709290
  9. Phosphorylated HtrA2/Omi cleaves beta-actin, reducing filamentous actin (F-actin) in the cytosol. PMID: 24662565
  10. Downregulation of PARL after ischemia reduces HtrA2 processing and increases neuronal vulnerability. PMID: 23921894
  11. Increased expression and leakage of Omi/HtrA2 enhance MI/R injury in aging hearts by degrading XIAP and promoting apoptosis. PMID: 22535253
  12. HtrA2 deficiency causes mtDNA damage through ROS generation and mutation, leading to mitochondrial dysfunction and cell death in aging cells. PMID: 23542127
  13. HtrA2-knockout cells show increased proton translocation through ATP synthase, decreased ATP production, and F1 alpha-subunit truncation, suggesting ATP synthase as the source of proton leak. PMID: 22739987
  14. A novel anti-apoptotic E3 ubiquitin ligase ubiquitinates SMAC, HtrA2, and ARTS, antagonists of IAPs. PMID: 23479728
  15. HtrA2 and Cdk5 interact in human and mouse cell lines and brain. PMID: 21701498
  16. HtrA2/Omi deletion reduces small-conductance Ca(2+)-activated potassium channel activity, causing irregular firing and enhanced burst firing in substantia nigra compacta dopamine neurons. PMID: 20926611
  17. Omi regulates autophagy and may be involved in cellular quality control of proteins implicated in neurodegenerative diseases. PMID: 20467442
  18. Reduced AICD production in mitochondria from Omi/HtrA2 knockout mouse embryonic fibroblasts indicates Omi/HtrA2's role in gamma-secretase activity. PMID: 20705111
  19. Omi/HtrA2 is involved in apoptotic signaling pathways in tubular epithelial cells activated by unilateral ureteral obstruction, leading to kidney fibrosis. PMID: 20219823
  20. Loss of Omi/HtrA2 affects mitochondrial morphology and modulates OPA1. PMID: 20064504
  21. Omi interacts with caspase-inhibitor XIAP and enhances caspase activity. PMID: 11803371
  22. Neurodegeneration and juvenile lethality in mnd2 mice result from a defect in mitochondrial Omi protease. PMID: 14534547
  23. Complete absence of HtrA2/Omi leads to striatal neuron loss and a Parkinsonian phenotype. PMID: 15509788
  24. Ischemia/reperfusion causes Omi/HtrA2 translocation from mitochondria to the cytosol, promoting cardiomyocyte apoptosis via a protease activity-dependent, caspase-mediated pathway. PMID: 15611365
  25. Omi/HtrA2 induces anoikis and regulates ras-induced transformation. PMID: 16461771
  26. HtrA2 regulates APP metabolism through endoplasmic reticulum-associated degradation. PMID: 17684015
  27. Neuronal HtrA2/Omi primarily protects neurons from stress, unlike its role in the somatic system. PMID: 17707776
  28. Hax1 suppresses apoptosis in lymphocytes and neurons through interaction with Parl and HtrA2. PMID: 18288109
  29. HtrA2 molecules are occupied by autoproteolytic peptide products, suggesting an autoregulatory mechanism relevant to HtrA-associated virulence in Mycobacterium tuberculosis. PMID: 18479146
  30. The homeostatic, not proapoptotic, function of Omi/HtrA2 is linked to the selective vulnerability of striatal neurons in Huntington's disease. PMID: 18662332
  31. Mpv17l interacts with and regulates HtrA2 protease, mediating antioxidant and antiapoptotic functions in mitochondria. PMID: 18772386
  32. Loss of HtrA2 upregulates integrated stress response genes in the brain, causing accumulation of unfolded proteins in mitochondria, defective mitochondrial respiration, and increased reactive oxygen species. PMID: 19023330
  33. Amyloid beta-binding serine protease Omi is a stress-relieving heat-shock protein protecting neurons from neurotoxic oligomeric amyloid beta. PMID: 19435805
Database Links
Protein Families
Peptidase S1C family
Subcellular Location
Mitochondrion intermembrane space. Mitochondrion membrane; Single-pass membrane protein. Note=Predominantly present in the intermembrane space. Released into the cytosol following apoptotic stimuli, such as UV treatment, and stimulation of mitochondria with BID.

Q&A

What is the basic structure and function of mouse HTRA2/Omi?

Mouse HTRA2/Omi is a mitochondrial serine protease that comprises:

  • An N-terminal mitochondrial targeting sequence (MTS)

  • A trypsin-like protease domain with conserved active site residues

  • A C-terminal PDZ domain

HTRA2 plays dual roles in cells:

  • Maintaining mitochondrial protein quality control and homeostasis under normal conditions

  • Contributing to apoptosis under cellular stress conditions

The protein exhibits trypsin-like protease activity that can be biochemically inhibited by the specific inhibitor ucf-101. The mature form exposes an N-terminal tetrapeptide (AVPS in humans, ALPS in P. falciparum) that can interact with Inhibitor of Apoptosis Proteins (IAPs) .

What mouse models are available for HTRA2 research?

Several mouse models have been developed for HTRA2 research:

Mouse ModelDescriptionPhenotypeLifespan
mnd2 miceHarbor S275C mutation causing loss of protease activityNeurodegeneration, motor abnormalities similar to Parkinson's diseaseDie between postnatal day 30-40
HtrA2 knockout miceComplete deletion of HtrA2 geneParkinsonian features, striatal neuron lossDie between postnatal day 30-40
Rescued mnd2 micemnd2 mice with neuron-specific expression of human HTRA2 transgeneRescued from neurodegeneration but develop accelerated aging phenotypesLive 12-17 months
Conditional knockoutTissue-specific deletion using Cre-loxP systemDepends on targeted tissueVaries based on deletion pattern

These models have revealed that HTRA2 deficiency in the CNS is directly responsible for the neurodegeneration and early lethality, while its absence in non-neuronal tissues contributes to aging phenotypes .

How does the PDZ domain regulate HTRA2 protease activity?

The C-terminal PDZ domain of HTRA2 serves as a critical regulatory element:

  • Under normal conditions, the PDZ domain blocks the protease active site, keeping HTRA2 in an inactive trimeric conformation

  • The PDZ domain mediates protein-protein interactions, facilitating formation of a large membrane-associated protein complex that acts as a chaperone for mitochondrial protein quality control

  • Upon cellular stress or apoptotic stimuli, N-terminal processing and phosphorylation events lead to conformational changes that remove the inhibitory effect of the PDZ domain from the active site

  • Surface plasmon resonance studies showed specific binding between the PDZ domain and protease domain with strong equilibrium dissociation constant (Kd value of 1.03×10-6)

Experimental evidence shows that recombinant PDZ domain can significantly inhibit the protease activity of the HTRA2 protease domain in vitro, confirming its regulatory role .

What molecular mechanisms link HTRA2 dysfunction to neurodegeneration?

HTRA2 dysfunction contributes to neurodegeneration through multiple mechanisms:

  • Loss of mitochondrial protein quality control leads to accumulation of unfolded proteins in the mitochondria

  • Genetic ablation of HTRA2 causes:

    • Significant growth inhibition

    • Decreased replication of mitochondrial DNA

    • Increased mitochondrial ROS production

    • Mitochondrial fission/fragmentation

    • Hindered parasite development

  • In mnd2 mice and HtrA2 knockout mice, loss of HTRA2 activity causes:

    • Extensive cell death in the Caudate-Putamen

    • Astrocyte infiltration (increased GFAP-positive cells)

    • Motor abnormalities resembling Parkinson's disease

HTRA2 mutations associated with Parkinson's disease (G399S, A141S, P143A, R404W) affect phosphorylation sites regulated by PINK1 and CDK5, both of which are Parkinson's disease-associated kinases . The G399S mutation specifically reduces phosphorylation at residue 400, which is critical for cellular stress response .

How does HTRA2 contribute to both cell survival and programmed cell death?

HTRA2 exhibits a remarkable dual functionality depending on cellular conditions:

Cell Survival Role:

  • Functions as a chaperone-protease maintaining mitochondrial protein homeostasis

  • Genetic ablation leads to mitochondrial dysfunction and cell death

  • Interestingly, inhibition of protease activity by ucf-101 has no effect on normal parasite growth, suggesting a non-protease/chaperone role is essential for survival

Cell Death Role:

  • Under cellular stress conditions, HTRA2 undergoes processing but remains localized in the mitochondrion

  • The processed form has increased protease activity and cleaves intra-mitochondrial substrates

  • Inhibition of HTRA2 by ucf-101 under stress conditions reduces activation of caspase-like proteases and parasite cell death

  • When released from mitochondria to cytosol in mammalian cells, HTRA2 binds and neutralizes IAPs via its N-terminal motif, promoting caspase activation

This functional duality positions HTRA2 as a cellular stress sensor that maintains mitochondrial function under normal conditions but promotes controlled cell death when damage is irreparable.

What is the relationship between HTRA2 dysfunction and mitochondrial DNA deletions in aging?

Rescued mnd2 mice (expressing HTRA2 only in neurons) develop accelerated aging phenotypes and show a direct link between HTRA2 dysfunction and mtDNA integrity:

  • Adult rescued mnd2 mice exhibit:

    • Premature weight loss

    • Hair loss

    • Reduced fertility

    • Curvature of the spine

    • Heart enlargement

    • Increased autophagy

    • Death by 12-17 months of age

  • These mice have significantly elevated levels of clonally expanded mtDNA deletions in their tissues

  • COX-negative muscle fibers from rescued mnd2 mice contain 6.5-8.5 Kb mtDNA deletions

  • These deletions occur in regions with 1-9 bp direct DNA repeats

These findings provide direct genetic evidence linking mitochondrial protein quality control to mtDNA deletions and aging in mammals, suggesting that HTRA2's role in maintaining mitochondrial proteostasis is crucial for preventing age-related mtDNA damage .

What methods are effective for measuring HTRA2 protease activity in vitro?

Researchers can employ several approaches to measure HTRA2 protease activity:

Fluorogenic Peptide Substrates:

  • Utilize synthetic peptides with fluorogenic moieties (e.g., AMC, AFC) that are released upon cleavage

  • Measure fluorescence intensity over time to determine reaction kinetics

  • For HTRA2, trypsin-like substrate specificity should be considered when selecting peptides

Inhibition Assays:

  • Use specific inhibitor ucf-101 at varying concentrations to establish inhibition curves

  • Calculate IC50 values to compare wild-type and mutant forms of HTRA2

Protein Substrate Cleavage:

  • Incubate recombinant HTRA2 with known protein substrates

  • Analyze cleavage products by SDS-PAGE and western blotting

  • Quantify the disappearance of full-length substrate or appearance of cleavage products

Assay Conditions Optimization:

  • Activity is temperature and pH-dependent

  • Include appropriate controls:

    • Catalytically inactive HTRA2 (e.g., S306A mutation)

    • Heat-denatured enzyme

    • Reactions with and without inhibitors

Recommended methodology includes recombinant expression of the protease domain (e.g., Ala134-Glu458 for human HTRA2) in E. coli with a purification tag, followed by activity measurement using the approaches outlined above .

How can researchers generate and validate conditional HTRA2 knockout models?

To generate conditional HTRA2 knockout models:

Design Strategy:

  • Create a targeting vector with loxP sites flanking critical exons (e.g., exons 2-4)

  • Include a FRT-flanked selection cassette (e.g., neo)

  • Target embryonic stem cells and confirm correct recombination by PCR and Southern blotting

Tissue-Specific Deletion:

  • Cross floxed HTRA2 mice with tissue-specific Cre lines:

    • Nestin-Cre for CNS-specific deletion

    • Albumin-Cre for liver-specific deletion

    • MHC-Cre for cardiac-specific deletion

Validation Methods:

  • Genomic PCR to confirm deletion of targeted exons

  • Western blotting to verify loss of HTRA2 protein in specific tissues

    • Use specific antibodies against HTRA2

    • Include loading controls (e.g., PHB2 for mitochondrial proteins)

  • Functional assays to confirm phenotypic changes

    • Morphological analysis of mitochondria

    • Measurement of mitochondrial ROS

    • Assessment of mtDNA integrity

As shown in previous research, PCR from genomic DNA can distinguish wild-type (279 bp), knockout (358 bp), and floxed (313 bp) alleles of HTRA2. Western blot analysis should confirm tissue-specific loss of HTRA2 protein while showing normal levels in non-targeted tissues .

What experimental approaches can identify substrates and interacting partners of HTRA2?

To identify HTRA2 substrates and interacting proteins:

Proteomics-Based Approaches:

  • Stable Isotope Labeling with Amino acids in Cell culture (SILAC) combined with mass spectrometry

  • Compare mitochondrial proteomes from wild-type and HTRA2-deficient cells

  • Proteins that accumulate in HTRA2-deficient cells are potential substrates

Proximity-Based Labeling:

  • Express HTRA2 fused to BioID or APEX2 in cells

  • Biotinylated proteins in proximity to HTRA2 can be purified and identified by mass spectrometry

Direct Binding Assays:

  • Yeast two-hybrid screening using HTRA2 as bait

  • Pull-down assays with recombinant HTRA2 (use catalytically inactive mutant to prevent substrate degradation)

  • Surface plasmon resonance (SPR) to quantify binding parameters, as demonstrated for PDZ-protease domain interactions (Kd value 1.03×10-6)

In Vitro Cleavage Assays:

  • Incubate recombinant HTRA2 with candidate substrate proteins

  • Analyze cleavage products by SDS-PAGE and mass spectrometry

  • Compare wild-type HTRA2 with catalytically inactive mutant as control

For verification of interactions in cells, co-immunoprecipitation followed by western blotting can be performed under both normal and stress conditions to identify condition-specific interactions.

How should experiments be designed to study HTRA2's role in stress-induced cell death?

To investigate HTRA2's role in stress-induced cell death:

Stress Induction Models:

  • ER stress: tunicamycin, thapsigargin, or DTT treatment

  • Mitochondrial stress: express proteolytically inactive mutant ClpQ fused with FKBP degradation domain

  • Oxidative stress: H2O2, paraquat, or rotenone treatment

Experimental Design:

  • Control Groups:

    • Wild-type cells/organisms

    • HTRA2 knockout or knockdown cells/organisms

    • Cells treated with HTRA2 inhibitor ucf-101

  • Key Assays:

    • Cell viability assays (MTT, ATP levels)

    • Caspase activation measurement

    • TUNEL assay for cell death quantification

    • Mitochondrial membrane potential assessment

    • Western blotting to detect HTRA2 processing (look for ~25 kDa band vs. ~43 kDa full-length protein)

  • Subcellular Fractionation:

    • Separate mitochondrial and cytosolic fractions

    • Track HTRA2 localization under stress conditions

    • Determine if HTRA2 remains in mitochondria or is released to cytosol

  • Rescue Experiments:

    • Re-express wild-type or mutant HTRA2 in knockout cells

    • Express HTRA2 protease domain in either mitochondria or cytosol to determine compartment-specific effects

Research has shown that under cellular stress, HTRA2 gets processed but remains localized in the mitochondrion, suggesting it acts by cleaving intra-mitochondrial substrates. This was supported by experiments showing that trans-expression of HTRA2 protease domain in the parasite cytosol was unable to induce cell death .

What are the emerging therapeutic targets related to HTRA2 dysfunction?

Recent research has identified several potential therapeutic targets:

  • PDZ-Protease Interaction Modulators: Compounds that modulate the interaction between PDZ and protease domains could potentially restore normal HTRA2 activity in disease states

  • Phosphorylation Site Targeting: Molecules that enhance phosphorylation at key regulatory sites (S142 and S400) might compensate for mutations that affect these regions (G399S, A141S)

  • Mitochondrial Quality Control Enhancement: Boosting alternative mitochondrial quality control pathways could compensate for HTRA2 dysfunction:

    • Upregulating mitophagy

    • Enhancing other mitochondrial proteases (e.g., LONP1, ClpXP)

  • Exploitation in Parasitic Diseases: Understanding the dual role of HTRA2 in Plasmodium falciparum suggests potential targets for antimalarial drug development:

    • Under normal conditions, HTRA2 is essential but protease activity is dispensable

    • Under stress, protease activity becomes crucial for parasite death

A key consideration for therapeutic development is that complete inhibition of HTRA2 may be detrimental, as shown by the phenotypes of knockout mice. Selective modulation of specific HTRA2 functions might be more beneficial.

How do the functions of mouse HTRA2 compare to human HTRA2 and other species homologs?

Comparative analysis of HTRA2 across species reveals:

Human and mouse HTRA2 show functional conservation, as demonstrated by rescue experiments where human HTRA2 expression in mouse neurons prevented neurodegeneration in mnd2 mice . This indicates that human and mouse HTRA2 are functional orthologs, supporting the translational relevance of mouse models.

The parasite homolog PfHtrA2 shows interesting functional divergence - while it maintains the core protease activity and is important for mitochondrial homeostasis, its regulation and role in cell death pathways appear to have evolved differently, suggesting species-specific adaptations of this conserved protease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.