Recombinant Mouse Serine protease inhibitor Kazal-type 10 (Spink10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
Spink10; Serine protease inhibitor Kazal-type 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Spink10
Target Protein Sequence
MKLSSLWSNAFVINVAIALYAETAFLSAPKLKIDCRPYLDSNDKCTREYHPVCSTSGKTY CNKCTFCKALRLDTMSSSLLWIKITFILALVVPFYYGTTFAFSKEARRQPDCDKYRTFPN QCTREWNPVCGTNGFTYSNECVFCNAKIAAKEKIDYRHFGPC
Uniprot No.

Target Background

Function

Probable serine protease inhibitor.

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in epydiymis, in the cauda and corpus. Also expressed in brain.

Q&A

What is the molecular structure of mouse Spink10 and how does it compare to other SPINK family proteins?

Mouse Serine protease inhibitor Kazal-type 10 (Spink10) is a member of the SPINK family characterized by at least one conserved Kazal domain with six consensus cysteines forming a 1–5/2–4/3–6 disulfide bond pattern . The protein consists of 162 amino acids and has a molecular weight of approximately 18.5 kDa . Like other SPINK family members, Spink10 functions as a serine protease inhibitor, regulating protease activities to prevent uncontrolled proteolysis .

When comparing Spink10 to other family members such as Spink1/Spink3 (mouse pancreatic trypsin inhibitor), there are structural similarities in the Kazal domain, but differences in tissue expression patterns and specific protease targets. While Spink1/Spink3 is primarily expressed in pancreas and male accessory glands , Spink10 shows high expression in the mouse epididymis along with Spink8, Spink1, and Spink12 .

What are the physiological roles of Spink10 in mouse models?

Based on current research, Spink10 appears to play important roles in reproductive biology, particularly in the epididymis where it is highly expressed . While specific functions of Spink10 are still being elucidated, studies of related SPINK family members suggest these inhibitors maintain equilibrium of protease activity for processes essential to sperm maturation and tissue integrity .

Like other epididymis-expressed SPINK proteins such as Spink13, Spink10 likely contributes to sperm maturation processes by protecting against proteolytic degradation and potentially modulating sperm function during fertilization . Research indicates these inhibitors may be important for assuring proper timing of processes like acrosome reaction during fertilization .

What are the recommended methods for detecting Spink10 expression in mouse tissue samples?

Detection of Spink10 in tissue samples can be accomplished through several complementary techniques:

  • ELISA: Commercial ELISA kits are available for quantitative measurement of mouse Spink10 in tissue homogenates, cell lysates, and biological fluids, with a typical detection range of 0.156-10 ng/ml .

  • Western Blotting: Using recombinant Spink10 proteins with tags (such as Strep Tag) as standards or controls, Western blot can detect native Spink10 in tissue extracts . Recommended working dilutions should be determined by the researcher, but typically start at 1:1000 for primary antibodies.

  • Immunohistochemistry: For localization studies, paraformaldehyde-fixed tissue sections can be probed with anti-Spink10 antibodies, similar to methods used for other SPINK family members.

  • RT-PCR/qPCR: For mRNA expression analysis, primers targeting specific regions of Spink10 can be designed. This approach has been successfully used for other SPINK family members, such as in studies of Spink13 expression .

TechniqueSample TypesSensitivityAdvantagesLimitations
ELISATissue homogenates, cell lysates, biological fluids0.156-10 ng/mlQuantitative, high-throughputLimited spatial information
Western BlotProtein extracts~1-10 ng depending on antibodySize verification, semi-quantitativeRequires tissue processing
IHCFixed tissue sectionsVariableSpatial localizationSemi-quantitative
RT-PCR/qPCRRNA extracts~10-100 copiesHigh sensitivity for mRNAMeasures transcript not protein

How can researchers effectively produce recombinant mouse Spink10 protein for functional studies?

The production of recombinant mouse Spink10 requires careful consideration of expression systems to ensure proper folding and biological activity. Based on protocols used for other SPINK family members:

  • Expression System Selection: While E. coli systems have been used for some SPINK proteins , yeast expression systems may be preferred for Spink10 to ensure proper disulfide bond formation critical to Kazal domain functionality .

  • Construct Design: Include the full coding sequence (AA 1-162) with appropriate tags for purification (6xHis or Strep tags are commonly used) . Consider codon optimization for the chosen expression system.

  • Purification Strategy:

    • Initial capture via affinity chromatography (Ni-NTA for His-tagged proteins)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for final polishing

    • Verify purity via SDS-PAGE (>90% purity is typically achievable)

  • Activity Verification: Test the inhibitory activity of purified Spink10 against candidate serine proteases using FRET substrates, similar to methods used for Spink3 . Calculate inhibition constants (Ki) to characterize potency.

How can loss-of-function and gain-of-function models be designed to study Spink10 in reproductive biology?

Designing appropriate genetic models for Spink10 requires strategic approaches to avoid potential developmental issues while achieving tissue-specific modulation:

Loss-of-Function Approaches:

  • Conditional Knockout Strategy: Given the potential importance of SPINK family members in development (as seen with Spink3/SPINK1 ), conditional knockout approaches using Cre-loxP technology are recommended. This allows for epididymis-specific deletion of Spink10 in adult mice, avoiding potential developmental lethality .

  • RNAi Knockdown: For temporary reduction of Spink10 expression, lentiviral delivery of shRNA can be employed, similar to methods used for Spink13 :

    • Design 3-4 different shRNA sequences targeting Spink10

    • Test knockdown efficiency in mouse epididymal epithelial cells (PC1)

    • Deliver validated constructs via direct injection into the epididymis

    • Confirm knockdown by RT-PCR and Western blot after 48-72 hours

  • CRISPR-Cas9 Gene Editing: For specific mutations or domain deletions, CRISPR-Cas9 can be used with appropriate guide RNAs targeting the Kazal domain.

Gain-of-Function Approaches:

  • Transgenic Overexpression: Create transgenic mice with Spink10 under control of tissue-specific promoters to examine effects of increased expression.

  • Recombinant Protein Administration: Purified recombinant Spink10 can be administered to specific tissues or systemically to assess acute effects.

  • X-Chromosome Integration: For mosaic expression patterns, the approach used for human SPINK1 rescue in Spink3-deficient mice could be adapted, integrating Spink10 on the X chromosome .

What methodological approaches are recommended for studying interactions between Spink10 and its target proteases?

To investigate the specific molecular interactions and inhibitory mechanisms of Spink10:

  • Inhibitory Target Identification:

    • Screen potential serine protease targets using recombinant Spink10 in protease activity assays with fluorogenic substrates

    • Calculate inhibition constants (Ki) for each enzyme to determine specificity profile

    • Compare with inhibitory profiles of other SPINK family members

  • Binding Kinetics Analysis:

    • Surface plasmon resonance (SPR) to determine association and dissociation rates

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Fluorescence polarization assays for high-throughput screening

  • Structural Analysis:

    • X-ray crystallography of Spink10-protease complexes

    • NMR studies for solution dynamics

    • Molecular docking and MD simulations to predict binding interfaces

  • Mass Spectrometry Analysis:

    • To determine whether Spink10 undergoes cleavage by target proteases (compare with Spink3 which is not truncated by trypsin )

    • To identify potential post-translational modifications affecting activity

What controls should be included when evaluating Spink10 function in mouse reproductive studies?

When designing experiments to evaluate Spink10 function, particularly in reproductive biology context:

Essential Controls:

  • Genetic Background Controls: Use littermates or mice of identical genetic background, as strain differences can significantly impact reproductive phenotypes .

  • Age-Matched Controls: Reproductive parameters vary with age; ensure experimental and control groups are precisely age-matched (within 1-2 weeks) .

  • Rescue Experiments: For knockdown or knockout studies, include rescue groups receiving recombinant Spink10 protein or expressing Spink10 via alternative delivery methods .

  • Conditioned Media Controls: When performing rescue experiments using conditioned media, include appropriate vector control conditioned media groups .

  • Antibody Specificity Controls: For immunodetection, include:

    • Pre-absorption controls with recombinant Spink10

    • Testing in tissues known to be negative for Spink10

    • Testing antibodies against other SPINK family members to confirm specificity

Experimental Design Recommendations:

  • Power analysis should be performed to determine sample sizes (typically 6-10 animals per group for reproductive studies)

  • Use at least three biological replicates and three technical replicates for molecular assays

  • For fertility studies, each male should be mated with multiple females (minimum two) to account for female variation

  • Blinded analysis should be employed for phenotypic evaluations

How can researchers address conflicting data when studying Spink10 in relation to other SPINK family members?

Resolving inconsistencies in SPINK family research requires systematic approaches:

  • Cross-Validation Strategy:

    • Employ multiple detection methods (protein vs. mRNA)

    • Use multiple antibodies targeting different epitopes

    • Confirm findings across different mouse strains

  • Address Nomenclature Confusion:

    • Be aware that mouse SPINK family nomenclature can be confusing (e.g., mouse SPINK1 is often called SPINK3 as a legacy name)

    • Clearly state the accession numbers and gene IDs in publications (Gene ID for Spink10: 328971)

  • Consider Redundancy and Compensation:

    • Assess expression of other SPINK family members when one is knocked down

    • Use combinatorial approaches targeting multiple SPINK proteins simultaneously

    • Evaluate potential rescue by related family members

  • Contextual Variables:

    • Hormonal status significantly affects SPINK expression; control for androgen levels

    • Age-dependent expression patterns should be systematically documented

    • Environmental factors (diet, housing conditions) should be standardized and reported

What statistical approaches are most appropriate for analyzing Spink10 expression and functional data?

For expression analysis:

  • Quantitative Comparisons Across Tissues:

    • For normally distributed data: One-way ANOVA with appropriate post-hoc tests (Tukey or Bonferroni)

    • For non-parametric data: Kruskal-Wallis with Dunn's post-hoc test

    • Report data as individual points with mean and standard deviation

  • Time-Course Studies:

    • Repeated measures ANOVA for longitudinal data

    • Mixed-effects models for handling missing data points

    • Consider area-under-the-curve analyses for cumulative effects

  • Correlation with Physiological Parameters:

    • Pearson or Spearman correlation depending on data distribution

    • Multiple regression analysis for controlling covariates

    • Consider principal component analysis for complex datasets

For functional studies:

  • Enzyme Kinetics Analysis:

    • Use non-linear regression for inhibition curves

    • Calculate and compare IC50 and Ki values with 95% confidence intervals

    • For complex mechanisms, use appropriate models (competitive, non-competitive, mixed)

  • Fertility Data Analysis:

    • Power analysis based on expected effect sizes

    • Consider both parametric and non-parametric approaches

    • Use p < 0.05 as statistically significant threshold

Data TypeRecommended TestSample Size RecommendationReporting Standard
Expression across tissuesOne-way ANOVA with Tukeyn ≥ 5 per groupMean ± SD with individual data points
Inhibition constantsNon-linear regression8-12 concentration pointsKi with 95% CI
Fertility outcomesMann-Whitney or t-testn ≥ 10 mating pairsMedian with range
Developmental timingRepeated measures ANOVAn ≥ 8 per groupTime-course graphs with error bars

How can researchers integrate Spink10 data with broader protease networks in reproductive biology?

To place Spink10 findings in a broader biological context:

  • Network Analysis Approaches:

    • Construct protease-inhibitor networks using known interactions

    • Integrate transcriptomic and proteomic data to identify co-regulated genes

    • Use pathway analysis tools (KEGG, Reactome) to map Spink10 to biological processes

  • Multi-omics Integration:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Use computational approaches to identify potential regulatory mechanisms

    • Apply machine learning for pattern recognition across datasets

  • Evolutionary Analysis:

    • Compare Spink10 function across species to identify conserved mechanisms

    • Study paralog relationships within the SPINK family

    • Identify species-specific adaptations that may inform function

  • Clinical Correlation:

    • Where appropriate, analyze correlations between mouse models and human reproductive disorders

    • Consider translational potential of findings in assisted reproductive technologies

What emerging technologies could advance our understanding of Spink10 biology?

Several cutting-edge approaches offer new possibilities for Spink10 research:

  • Single-Cell Technologies:

    • Single-cell RNA-seq to identify specific cell populations expressing Spink10

    • Single-cell proteomics to detect protein at cellular resolution

    • Spatial transcriptomics to map expression patterns in tissue context

  • Advanced Microscopy:

    • Super-resolution microscopy for subcellular localization

    • Live-cell imaging with fluorescently tagged Spink10

    • FRET-based biosensors to monitor protease activity in real-time

  • Genome Editing Advances:

    • Base editing for precise mutation introduction

    • Prime editing for complex genetic modifications

    • Inducible CRISPR systems for temporal control of gene editing

  • Protein Engineering:

    • Design of Spink10 variants with altered specificity

    • Creation of chimeric inhibitors combining domains from different SPINK proteins

    • Development of small molecule mimetics based on Spink10 structure

How might Spink10 research contribute to understanding human reproductive disorders?

While direct translational applications require caution, potential clinical relevance includes:

  • Male Infertility:

    • Investigation of human orthologs in idiopathic male infertility

    • Potential diagnostic biomarkers for specific forms of infertility

    • Development of novel therapeutic approaches for reproductive medicine

  • Protease Dysregulation Disorders:

    • Insights from Spink10 may inform understanding of protease-inhibitor imbalances in human pathologies

    • Model for studying inhibitor resistance mechanisms

  • Comparative Biology Approaches:

    • Evolutionary conservation analysis to identify essential vs. species-specific functions

    • Cross-species comparisons to identify potential redundancy in inhibitory networks

  • Therapeutic Development:

    • Engineered SPINK proteins as potential therapeutic agents

    • Insights for designing protease inhibitors with improved specificity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.