Recombinant Mouse Serine-rich and transmembrane domain-containing protein 1 (Sertm1)

Shipped with Ice Packs
In Stock

Description

Key Properties

PropertyDescriptionSource
Gene SymbolSertm1 (Mouse) / SERTM1 (Human)
UniProt IDQ8CD78 (Mouse) / A2A2V5 (Human)
Amino Acid Sequence107 residues; includes serine-rich motifs and hydrophobic transmembrane regions
Expression RegionFull-length (1–107 aa)
TagsStrep Tag, His6ABP (Albumin Binding Protein) for purification

Notable Features

  • Transmembrane Domains: Facilitates localization to intracellular membranes and organelles .

  • Serine-rich Regions: Mediates protein-protein interactions and post-translational modifications .

Predicted Functional Partners

Sertm1 interacts with proteins involved in ion transport, apoptosis regulation, and organelle dynamics. Key partners include:

ProteinFunctionInteraction ScoreSource
TMEM14AInhibits mitochondrial outer membrane permeabilization (anti-apoptotic)0.489
CACNG4Regulates voltage-gated calcium channels and AMPA receptors0.526
KCNB2Voltage-gated potassium channel subunit0.507
FAM91A1Facilitates vesicle capture via AP-1-dependent pathways0.505

Cellular Localization

  • Primary: Intracellular membrane-bounded organelles (e.g., ER, Golgi) .

  • Subcellular: Predicted to localize to the plasma membrane and organelle membranes .

Production Systems and Tags

SystemTag/ConjugatePurification MethodApplication FocusSource
E. coliHis6ABP (N-terminal)IMAC chromatographyAntibody blocking assays
Cell-Free SynthesisStrep TagAffinity chromatographyELISA, SDS-PAGE, Western Blot
BaculovirusNot specifiedNot detailedStructural studies

Key Considerations

  • Stability: Recombinant Sertm1 is stored at -20°C in Tris-based buffers with 50% glycerol .

  • Activity: Proteins expressed via cell-free synthesis (CFPS) retain enzymatic functionality .

Experimental Uses

ApplicationProtocolReference
Antibody ValidationUse 100× molar excess of recombinant Sertm1 to block antibody binding in IHC/ICC/WB
ELISACoat plates with Sertm1 to detect anti-Sertm1 antibodies
Apoptosis StudiesCo-express with TMEM14A to study mitochondrial membrane stability

Expression Profile

TissueExpression LevelSource
BrainHigh
TestisModerate
LiverLow

Cancer and Mutation Data

  • COSMIC Database: Mutations in SERTM1 are observed in 416 samples across cancers, though it is not classified as a census gene .

  • Functional Impact: Mutations may disrupt organelle membrane integrity or ion channel regulation .

Comparative Analysis of Recombinant Sertm1 Products

Product SourceSequence CoverageTags/ConjugatesPurity (>0.5 mg/mL)Applications
Bio-Techne (NBP2-57568PEP)Partial (aa 1–107)His6ABPYesAntibody blocking
Genebiosystems (CSB-CF806998MO)Full-length (1–107)Not specifiedNot detailedStructural studies
Antibodies-Online (ABIN3125883)Full-length (1–107)Strep TagYesELISA, WB

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
Sertm1; Serine-rich and transmembrane domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Sertm1
Target Protein Sequence
MSEADSSSGFAGSVENGTFLELFPTSLSTSVDSSSGHLSNVYIYVSIFLSLLAFLLLLLI IALQRLKNIISSSSSYPEYPSDAGSSFTNLEVCSISSQRSTFSNLSS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Serine-rich and Transmembrane Domain-containing Protein 1 (Sertm1)?

Sertm1 is a protein-coding gene that encodes a serine-rich transmembrane protein. The protein contains heavily glycosylated serine-rich repeat (SRR) motifs and a transmembrane domain that anchors it to the cell membrane . Unlike bacterial SRR proteins which function as adhesins, mammalian Sertm1 appears to have distinct cellular functions that are still being characterized in research settings. The full name of this protein is "serine rich and transmembrane domain containing 1," and it belongs to a broader family of serine-rich proteins that are characterized by their high serine content and transmembrane localization .

What are the structural characteristics of mouse Sertm1?

Mouse Sertm1 protein has several distinct structural domains:

  • A signal peptide region at the N-terminus

  • Serine-rich regions with numerous serine residues that are potential sites for O-glycosylation

  • A transmembrane domain that anchors the protein to cellular membranes

  • Cytoplasmic domain at the C-terminus

While not identical to bacterial SRRPs, we can draw some structural parallels. In SRRPs, the serine-rich domains (SRR-1 and SRR-2) contain heavily glycosylated serine residues arranged in repetitive motifs . Similarly, mouse Sertm1 contains serine-rich regions that may be subjected to extensive post-translational modifications, particularly glycosylation, which can significantly influence protein function and interactions with other cellular components.

How does mouse Sertm1 compare to Sertm1 in other species?

Similar serine-rich proteins have been identified in various mammalian species, including the small Madagascar hedgehog (Echinops telfairi), where SERTM1 is also a protein-coding gene (Gene ID: 101640126) . Cross-species analysis suggests evolutionary conservation of key functional domains while allowing for species-specific adaptations.

What signaling pathways is mouse Sertm1 involved in?

The signaling activities of mouse Sertm1 remain under investigation, but research points to potential roles in:

  • Neuronal signaling pathways: Expression patterns in the olfactory system suggest potential involvement in neuronal projection and signaling

  • Cellular adhesion networks: Based on structural similarities with other serine-rich proteins that function in cell-cell interactions

  • Immune signaling: Some evidence suggests potential roles in immune cell function

Research approaches to investigate Sertm1 signaling include:

  • Phosphoproteomics to identify post-translational modifications following Sertm1 activation

  • Co-immunoprecipitation to identify protein binding partners

  • Transcriptomics to examine downstream gene expression changes

  • CRISPR-Cas9 knockout models to observe signaling defects in the absence of Sertm1

How do post-translational modifications affect mouse Sertm1 function?

Serine-rich domains in proteins are frequently subjected to extensive post-translational modifications, particularly O-glycosylation. Research on related proteins suggests that:

  • Glycosylation patterns: Different glycan combinations can exist on serine residues, with some regions showing higher glycosylation diversity than others. For example, in bacterial SRRPs, the SRR-1 domain has demonstrated higher glycosylation diversity with up to 24 different glycan combinations .

  • Functional implications: The glycosylation status likely affects:

    • Protein stability and half-life

    • Protein-protein interactions

    • Cellular localization and trafficking

    • Recognition by receptors or antibodies

  • Structural consequences: Glycosylation may act as "tent poles" for the protein structure, providing rigidity or flexibility to different protein regions, similar to what has been observed in related proteins .

Methodological approach for studying these modifications:

  • Liquid chromatography with tandem mass spectrometry (LC-MS/MS) using multiple proteases to capture the full diversity of glycosylation patterns

  • Site-directed mutagenesis of key serine residues to assess functional consequences

  • Glycoproteomics to characterize the types and patterns of glycosylation

What is the role of mouse Sertm1 in neuronal projection targeting?

Evidence from molecular characterization studies of projection neurons suggests potential involvement of certain transmembrane proteins in neuronal projection targeting. While direct data for Sertm1 is limited, research on projection neurons provides a framework for investigation:

  • Expression patterns: Transmembrane proteins with specific expression in certain neuronal subtypes often contribute to their projection specificity

  • Target identification: Some proteins related to Sertm1 have been identified in studies using targeted snRNA-seq experiments that validate molecularly defined neuronal cell types with distinct projection targets

  • Methodological approach:

    • Two-color single-molecule fluorescence in situ hybridization (smFISH) to identify co-expression with known neuronal markers

    • Lineage tracing experiments with Sertm1 reporter constructs

    • Cellular analysis using principal component analysis and UMAP projection to identify relationships between Sertm1-expressing cells and known neuronal subtypes

What are the optimal conditions for expressing recombinant mouse Sertm1?

Recombinant expression of transmembrane proteins with extensive post-translational modifications requires careful consideration of expression systems:

Expression SystemAdvantagesDisadvantagesRecommended for Sertm1
E. coliHigh yield, low costLacks glycosylation machineryNot recommended for full-length protein
Insect cellsModerate glycosylation, high yieldMay have different glycosylation patternsSuitable for structural studies
Mammalian cells (CHO, HEK293)Native-like glycosylationLower yield, higher costOptimal for functional studies
Cell-free systemsRapid productionLimited post-translational modificationsSuitable for domain-specific studies

Recommended protocol:

  • Clone the full-length mouse Sertm1 cDNA into a mammalian expression vector (e.g., pcDNA3.1) with appropriate tags (His, FLAG) for purification and detection

  • Transfect HEK293T cells using lipofection or calcium phosphate methods

  • Culture in serum-free media supplemented with appropriate glycosylation precursors

  • Harvest cells 48-72 hours post-transfection

  • Lyse cells in the presence of detergents suitable for transmembrane proteins (e.g., DDM, CHAPS)

  • Purify using affinity chromatography

How can I design effective knockout or knockdown experiments for mouse Sertm1?

CRISPR-Cas9 knockout approach:

  • Target guide RNA design:

    • Design 3-4 sgRNAs targeting early exons of the Sertm1 gene

    • Avoid regions with high homology to other genes

    • Verify specificity using BLAST and off-target prediction tools

  • Validation strategy:

    • PCR amplification and sequencing of the targeted region

    • Western blot using Sertm1-specific antibodies

    • RT-qPCR to confirm reduction in mRNA levels

RNA interference approach:

  • Design 3-4 siRNA or shRNA sequences targeting different regions of Sertm1 mRNA

  • Test knockdown efficiency using RT-qPCR and Western blot

  • Include appropriate controls (scrambled siRNA, non-targeting shRNA)

Phenotypic assessment:

  • Cellular assays: proliferation, migration, adhesion

  • Biochemical assays: protein-protein interactions, pathway activation

  • For in vivo studies: conditional knockout approaches may be needed if conventional knockout causes developmental defects

What antibodies and detection methods are most reliable for mouse Sertm1 research?

When selecting antibodies for Sertm1 detection, consider the following:

  • Epitope selection: Target regions with lower glycosylation to avoid interference with antibody binding

  • Validation methods:

    • Western blot with recombinant protein as positive control

    • Immunoprecipitation followed by mass spectrometry

    • Reduced signal in knockout/knockdown models

    • Cross-reactivity testing with related proteins

  • Detection methods comparison:

MethodSensitivitySpecificityApplications
Western blotModerateHigh with validated antibodiesProtein expression levels, molecular weight
ImmunofluorescenceHighModerate (requires validation)Subcellular localization
Flow cytometryHighHigh with proper controlsCell surface expression, sorting of positive cells
ELISAVery highHigh with validated antibodiesQuantification in biological fluids
Mass spectrometryVery highVery highIdentification, post-translational modifications
  • Recommendation: Use a combination of methods for robust detection, and when possible, include recombinant protein standards and knockout/knockdown samples as controls.

How do I interpret contradictory findings about mouse Sertm1 function in different experimental systems?

When facing contradictory results about Sertm1 function, consider these systematic approaches:

  • Cell type and context dependency:

    • Sertm1 may function differently in various cell types due to interactions with cell-specific proteins

    • Document all experimental conditions, including cell types, culture conditions, and passage numbers

    • Design experiments to test function across multiple cell lines/types

  • Post-translational modification differences:

    • Variations in glycosylation between experimental systems may alter function

    • Use glycosylation inhibitors or site-directed mutagenesis to test this hypothesis

    • Apply glycoproteomics to characterize modification patterns in different systems

  • Technical resolution approach:

    • Create a comparison table of experimental conditions across studies

    • Perform meta-analysis where possible to identify patterns

    • Design bridging experiments that connect contradictory findings by systematically varying conditions

  • Collaborative resolution:

    • Establish collaborations with labs reporting contradictory findings

    • Exchange reagents, protocols, and personnel to identify sources of variation

    • Consider multi-lab validation studies with standardized protocols

What bioinformatics tools are most appropriate for analyzing mouse Sertm1 sequence and structural features?

For comprehensive analysis of mouse Sertm1, the following computational tools and approaches are recommended:

  • Sequence analysis:

    • NCBI BLAST for homology searches and evolutionary comparisons

    • TMHMM/HMMTOP for transmembrane domain prediction

    • SignalP for signal peptide prediction

    • NetOGlyc and NetNGlyc for glycosylation site prediction

  • Structural prediction:

    • AlphaFold for tertiary structure prediction, though confidence may be lower in heavily glycosylated regions

    • GLYCAM web tool for molecular dynamics glycoprotein building and simulation

    • I-TASSER for comparative modeling

  • Expression and interaction analysis:

    • Gene Expression Omnibus (GEO) for transcriptomic data mining

    • STRING database for protein-protein interaction networks

    • CellTypist or similar tools for cell-type specific expression analysis

    • Seurat for single-cell RNA-seq data analysis

  • Integrated analysis workflow:

    • Start with sequence analysis to identify domains and motifs

    • Proceed to structural modeling, recognizing limitations in glycosylated regions

    • Integrate with expression and interaction data to build functional hypotheses

    • Validate computational predictions experimentally

How do I design experiments to determine the physiological relevance of mouse Sertm1 in specific tissues?

To establish physiological relevance of Sertm1, consider this comprehensive experimental design approach:

  • Expression profiling across tissues and developmental stages:

    • Single-cell RNA-seq to identify cell type-specific expression patterns

    • Temporal expression analysis during development and in disease models

    • Spatial transcriptomics to map expression within complex tissues

  • Functional perturbation in physiologically relevant systems:

    • Tissue-specific and inducible knockout mouse models using Cre-loxP system

    • Primary cell cultures from relevant tissues with CRISPR-mediated editing

    • Organoid models to study function in 3D tissue context

  • Phenotypic analysis with increasing complexity:

    • Begin with cellular phenotypes (proliferation, migration, differentiation)

    • Progress to tissue-level phenotypes (histology, tissue architecture)

    • Assess system-level phenotypes (physiology, behavior)

  • Mechanistic validation:

    • Rescue experiments with wild-type and mutant Sertm1

    • Identification of physiological binding partners through proximity labeling (BioID, APEX)

    • Target gene expression analysis in knockout vs. wild-type tissues

  • Disease relevance assessment:

    • Analysis in disease models where Sertm1 is implicated

    • Correlation of expression/mutation with disease progression

    • Therapeutic targeting potential evaluation

This systematic approach ensures rigorous evaluation of Sertm1's physiological roles while building from molecular mechanisms to whole-organism relevance.

What are the implications of Sertm1 in neurological disorders?

Current research suggests potential connections between Sertm1 and neurological function. Clinical genetic testing for SERTM1 in the context of hereditary disease indicates possible disease associations . When investigating Sertm1's role in neurological disorders, consider:

  • Expression analysis in neurological disease models:

    • Compare Sertm1 expression in affected vs. unaffected tissues

    • Analyze single-cell transcriptomics data from patient samples

    • Examine correlation with disease progression markers

  • Functional investigation approaches:

    • Assess neuronal morphology, connectivity, and electrophysiological properties in Sertm1-deficient neurons

    • Evaluate behavioral phenotypes in conditional knockout models

    • Test for interactions with known neurological disease proteins

  • Translational research directions:

    • Develop tools to modulate Sertm1 function (peptide inhibitors, antibodies)

    • Screen for small molecules that alter Sertm1 glycosylation or protein interactions

    • Evaluate biomarker potential in patient samples

While direct evidence linking mouse Sertm1 to specific neurological conditions is still emerging, its expression pattern and structural features warrant further investigation in neuronal function and dysfunction contexts.

How does glycosylation pattern heterogeneity affect Sertm1 function in different research models?

The extensive glycosylation of serine-rich proteins creates significant functional diversity. Based on studies of related proteins, glycosylation pattern heterogeneity may have profound effects:

  • Comparative glycobiology approach:

    • Analyze glycosylation patterns across different cell types and species

    • Identify conserved vs. variable glycosylation sites

    • Compare functional outcomes when glycosylation patterns differ

  • Methodological considerations:

    • Employ multiple proteases for LC-MS/MS analysis to capture the full diversity of glycopeptides

    • Use glycosidase treatments to assess function with and without specific glycan types

    • Apply glycoengineering to create defined glycoforms for functional testing

  • Functional correlation analysis:

    • Map glycosylation patterns to specific functional outcomes

    • Identify glycan "signatures" associated with particular activities

    • Develop predictive models of function based on glycosylation patterns

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.