Recombinant Mouse Serine/threonine-protein kinase VRK2 (Vrk2)

Shipped with Ice Packs
In Stock
Cat. No.
BT2503268
Source
in vitro E.coli expression system
Synonyms
Vrk2; Serine/threonine-protein kinase VRK2; Vaccinia-related kinase 2
Quick Inquiry

Description

Introduction to Recombinant Mouse Serine/Threonine-Protein Kinase VRK2

Recombinant Mouse Serine/Threonine-Protein Kinase VRK2, also known as Vaccinia-related kinase 2, is a recombinant protein derived from the mouse genome. It is expressed in Escherichia coli and is available as a lyophilized powder with a purity of greater than 90% as determined by SDS-PAGE . This protein is crucial for various cellular processes, including cell signaling and regulation of apoptosis.

Structure and Isoforms of VRK2

VRK2 in humans has two isoforms: VRK2A and VRK2B. VRK2A is the major form, consisting of 508 amino acids with a transmembrane domain that localizes it to the endoplasmic reticulum and mitochondria. In contrast, VRK2B is a shorter isoform with 397 amino acids, lacking the transmembrane domain and found in the cytosol and nucleus . The recombinant mouse VRK2 protein is full-length, comprising 503 amino acids, and is His-tagged for easy purification .

Biological Functions of VRK2

VRK2 plays significant roles in cellular processes:

  • Apoptosis Regulation: VRK2A interacts with Bcl-xL to modulate the intrinsic apoptotic pathway, providing protection against apoptosis .

  • Cell Signaling: VRK2 is involved in cell signaling pathways, potentially influencing cell survival and proliferation.

  • Protein-Protein Interactions: VRK2 interacts with various proteins, including Akt, to regulate lysosomal functions and viral replication .

4.2. Role in Disease

VRK kinases, including VRK2, have been implicated in cancer progression, although detailed molecular studies are needed to fully understand their roles. The expression of VRK kinases could potentially serve as prognostic markers or therapeutic targets in various cancers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Vrk2; Serine/threonine-protein kinase VRK2; Vaccinia-related kinase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-503
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Vrk2
Target Protein Sequence
MAPRRKEKYKLPVPLPEGKILDDMEGNRWALGKMIGSGGFGLIYLAFPTNKPNKDARHVI KLEYQENGPLFSELKFYQRAAKRECIQKWIQQRKLDYLGIPVFYGFGLTDFKGRSYRFMV MERLGIDLQKLLDQNGGFKKLTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLDFTNPD RVYLADYGLSYRYCPNGNHKQYQEDPRKGHNGTIEFTSLDAHKGVAPSRRSDVEILGYCM LHWLFGKLPWEAKLDDPVAVQTAKTNLLDELPESVLKWAPSGSSCSELVKYLMYVHNLAY DDKPDYQKLKKILNPDGVPLGPLEFSTKVQSVHVRTPAQQKVDSPKATRKPANEFPAKFP KKVHRETRARQREEQEDSQPTMLQSRPAAPENSRTRKIHEYSDIFSEMQSLQQTPSYMSF QGSYCKPYLDCTRRDPIRKPRSLPRYRHTPTGNLGVTDLESSPRFWPAIFQLTLSEETKA DVYYYGITIFCLLIFVFLALYFL
Uniprot No.
Q8BN21

Target Background

Function
Recombinant Mouse Serine/threonine-protein kinase VRK2 (Vrk2) is a serine/threonine kinase regulating various signal transduction pathways. Isoform 1 modulates the cellular stress response to hypoxia and cytokines (e.g., interleukin-1 beta (IL1B)), dependent on its interaction with MAPK8IP1, which facilitates the assembly of mitogen-activated protein kinase (MAPK) complexes. Inhibition of MAPK8IP1-MAPK complex-mediated signaling reduces JNK phosphorylation and JUN-dependent transcription. VRK2 phosphorylates histone H3 and 'Thr-18' of p53/TP53, enhancing p53 stability and activity. It also phosphorylates BANF1, disrupting its DNA-binding ability and reducing its interaction with LEM domain-containing proteins. Furthermore, VRK2 downregulates ERBB2, HRAS, BRAF, and MEK1-induced transcriptional transactivation and blocks ERK phosphorylation in response to ERBB2 and HRAS. It may also phosphorylate MAPK8IP1. While VRK2 can phosphorylate casein, MBP, and histone H2B in vitro, the physiological relevance of these substrates remains unclear.
Gene References Into Functions
  1. VRK genes play a role in embryonic hematopoiesis. PMID: 12782311
Database Links

KEGG: mmu:69922

STRING: 10090.ENSMUSP00000077471

UniGene: Mm.285351

Protein Families
Protein kinase superfamily, CK1 Ser/Thr protein kinase family, VRK subfamily
Subcellular Location
Cytoplasm. Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Mitochondrion membrane; Single-pass type IV membrane protein. Nucleus envelope.
Tissue Specificity
Expressed in liver, kidney and muscle. Weakly expressed in thymus, bone marrow and spleen.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.