Recombinant Mouse Short-chain dehydrogenase/reductase 3 (Dhrs3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Short-chain Dehydrogenase/Reductase 3 (Dhrs3)

Recombinant Mouse Short-chain Dehydrogenase/Reductase 3 (Dhrs3) is a protein involved in the metabolism of retinoids, specifically in the reduction of retinaldehyde to retinol. This enzyme plays a crucial role in regulating the levels of all-trans-retinoic acid (ATRA), a derivative of vitamin A essential for embryonic development and tissue differentiation.

Function and Importance of Dhrs3

Dhrs3 is critical for preventing the accumulation of excess ATRA during embryonic development. ATRA is a potent morphogen that influences various developmental processes, including organogenesis and cell differentiation. The absence or deficiency of Dhrs3 leads to increased ATRA levels, resulting in developmental abnormalities such as cardiac outflow tract defects, atrial and ventricular septation issues, skeletal malformations, and palatogenesis problems .

Key Functions:

  • Retinoid Metabolism: Dhrs3 reduces retinaldehyde to retinol, thereby controlling ATRA production.

  • Developmental Regulation: Essential for maintaining appropriate ATRA levels during embryonic development.

  • Tissue Expression: Expressed in multiple embryonic and adult tissues, including the retina .

Embryonic Development Studies

Studies using Dhrs3-deficient mice have shown that the lack of this enzyme leads to a significant increase in ATRA levels, resulting in embryonic lethality and developmental defects. These defects include axial and cranial skeletal anomalies, such as the fusion of cervical vertebrae .

Gene Expression and Regulation

The expression of Dhrs3 is influenced by several factors, including ATRA itself, which up-regulates Dhrs3 expression. Additionally, Dhrs3 expression is modulated by other transcription factors like p53, p63, RXR, and PPARγ .

Role in Cancer

Recent studies have explored the role of Dhrs3 in cancer, particularly in gastric cancer (GC), where Dhrs3 is often hypermethylated, leading to reduced expression. Overexpression of Dhrs3 in GC cells has been shown to inhibit cell migration and proliferation by inducing cell cycle arrest and apoptosis .

Table 1: Effects of Dhrs3 Deficiency on Retinoid Metabolites

MetaboliteChange in Dhrs3-/- Embryos
ATRA40% Increase
Retinol60% Decrease
Retinyl Esters55% Decrease

Table 2: Developmental Defects in Dhrs3-/- Embryos

DefectDescription
Cardiac Outflow TractDefects in formation
Atrial and Ventricular SeptationAbnormalities in septation
Skeletal DevelopmentAxial and cranial skeletal anomalies
PalatogenesisDefects in palate formation

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are default shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer ingredients, storage temperature and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Dhrs3; Rsdr1; Short-chain dehydrogenase/reductase 3; Retinal short-chain dehydrogenase/reductase 1; retSDR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Dhrs3
Target Protein Sequence
MVWKWLGALVVFPLQMIYLVTKAAVGMVLPPKLRDLSRESVLITGGGRGIGRHLAREFAE RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQMAKAVREKVGDITIL VNNAAVVHGKSLMDSDDDALLKSQHVNTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALS AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP LKPETVARRTVDAVQQNQALLLLPWTMNILIILKSILPQAALEEIHRFSGTYTCMNTFKG RT
Uniprot No.

Target Background

Function
Catalyzes the reduction of all-trans-retinal to all-trans-retinol in the presence of NADPH.
Gene References Into Functions
  1. Epicardial upregulation of the DHRS3 gene results in defective coronary vessel development. PMID: 29689192
  2. Yap targets Dhrs3, reducing retinoic acid synthesis and inhibiting cardiac fibroblast differentiation during development. PMID: 29689192
  3. Dhrs3 plays crucial roles in the development of the heart and coronary vasculature by regulating retinoic acid formation. PMID: 29447006
  4. DHRS3 is essential in limiting retinoic acid formation to ensure proper development of the coronary vasculature. PMID: 29447006
  5. DHRS3 is critical for preventing the formation of excessive retinoic acid during embryonic development. A lack of DHRS3 leads to increased retinoic acid levels, decreased retinol and retinyl ester levels, and alterations in the expression of retinoic acid-regulated genes. Consequently, Dhrs3-deficient embryos exhibit developmental defects in the heart, palate, and skeleton and are not viable. PMID: 24005908
  6. The reduction of retinaldehyde by DHRS3 is crucial for preventing the formation of excessive ATRA during embryonic development. PMID: 24005908
  7. p53-Inducible DHRS3 is an endoplasmic reticulum protein associated with lipid droplet accumulation. PMID: 21659514

Show More

Hide All

Database Links
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
In the embryo, expressed in developing osteogenic and chondrogenic tissues of vertebra, rib, tooth and limb bud.

Q&A

What is the primary function of Dhrs3 in retinoic acid metabolism?

Dhrs3 functions as a retinal reductase that attenuates retinoic acid signaling by converting all-trans-retinal (atRAL) to all-trans-retinol (atROL). This enzymatic activity effectively reduces the substrate availability for the synthesis of all-trans-retinoic acid (atRA), the active metabolite of vitamin A signaling . Unlike Cyp26 enzymes that degrade existing atRA, Dhrs3 works upstream in the pathway by removing the precursor, thereby regulating the rate of atRA synthesis rather than its degradation . Experimental evidence has shown that overexpression of Dhrs3 reduces endogenous atRA levels in embryos, while knockdown increases atRA concentration, demonstrating its negative regulatory role in RA signaling .

How does Dhrs3 expression relate to embryonic development?

Dhrs3 is essential for proper embryonic patterning, particularly in anteroposterior (AP) axis formation, neuroectoderm development, and somitogenesis . In Xenopus embryos, Dhrs3 shows a complementary expression pattern to aldh1a2 (a key atRA-synthesizing enzyme) during neurulation . Loss-of-function studies using antisense morpholino oligonucleotides have demonstrated that Dhrs3 knockdown results in shortened AP axis and reduced head structures, phenocopying the effects of excessive RA exposure . These developmental defects can be rescued by co-injection with Dhrs3 mRNA, confirming the specificity of the knockdown effect and the critical role of Dhrs3 in maintaining proper RA signaling balance during embryogenesis .

What are the optimal methods for assessing Dhrs3 enzymatic activity?

The enzymatic activity of recombinant mouse Dhrs3 can be effectively measured through several complementary approaches:

Cell-based Luciferase Assay:
A retinoic acid-responsive element-driven luciferase reporter system in HEK293T cells can indirectly measure the impact of Dhrs3 on atRA levels . This method can detect changes within the range of 10^-7 to 10^-11 M of atRA, making it suitable for quantifying the effects of Dhrs3 overexpression or knockdown .

LC-MS Analysis:
For direct quantification of retinoid metabolites, liquid chromatography-mass spectrometry (LC-MS) provides higher sensitivity and specificity. This method can be used to measure endogenous atRA levels in embryonic tissues or cell cultures expressing recombinant Dhrs3 .

Rescue Experiments:
Functional activity of Dhrs3 can be validated through rescue experiments where phenotypes induced by altered RA signaling are reversed. For example, posterior axis truncation caused by Dhrs3 overexpression can be alleviated by supplementation with sub-teratogenic doses of atRAL (0.5 μM) .

How can the specificity of Dhrs3 knockdown be verified in experimental models?

Verifying knockdown specificity is critical for attributing observed phenotypes to Dhrs3 function. A comprehensive approach includes:

  • In vitro translation inhibition: Testing the ability of antisense morpholino oligonucleotides (MO) to inhibit translation of Dhrs3 constructs in cell-free systems .

  • Co-injection experiments: Co-injecting Dhrs3 MO with tagged Dhrs3 mRNA (e.g., Dhrs3-FLAG) into embryos and confirming suppression of protein expression via Western blot .

  • Phenotypic rescue: Co-injecting wild-type Dhrs3 mRNA with Dhrs3 MO should rescue the knockdown phenotype if the effects are specific .

  • Molecular markers: Examining the expression of RA-responsive genes (e.g., hoxd1, gbx2, cdx4) following Dhrs3 knockdown and rescue .

  • Retinoid level measurement: Quantifying atRA levels in knockdown embryos using LC-MS or cell-based luciferase assays to confirm the expected increase in RA signaling .

How does Dhrs3 interact with other components of the retinoic acid metabolic pathway?

Dhrs3 functions within a complex network of enzymes regulating retinoid metabolism. Its interactions with other pathway components include:

EnzymeInteraction with Dhrs3Functional Significance
Aldh1a2Competitive - both enzymes utilize atRAL as substrateDhrs3 counteracts Aldh1a2-mediated conversion of atRAL to atRA
Rdh10Sequential - Rdh10 produces atRAL, which Dhrs3 converts back to atROLDhrs3 can reverse the effects of Rdh10 by consuming its product
Cyp26a1Complementary - both enzymes reduce RA signaling through different mechanismsCombined overexpression enhances phenotypes of RA signaling inhibition

In experimental settings, Dhrs3 has been shown to partially rescue phenotypes induced by Aldh1a2 overexpression in the presence of atRAL . Similarly, co-expression of Dhrs3 with Rdh10 reduces the expression of RA-responsive genes (hoxd1, gbx2, cdx4) that are normally induced by Rdh10 in the presence of atROL . These interactions highlight how Dhrs3 functions as a key modulator in the retinoid metabolic network, creating a balance between synthesis and degradation pathways.

What are the potential mechanisms regulating Dhrs3 expression and activity?

Dhrs3 regulation occurs at multiple levels:

  • Transcriptional regulation:

    • Dhrs3 expression is inducible by atRA treatment, suggesting positive feedback regulation

    • Xenopus nodal related 1 (xnr1) overexpression can induce Dhrs3 expression, indicating involvement of TGF-β signaling in its regulation

  • Spatial regulation:

    • Dhrs3 shows complementary expression patterns to aldh1a2 during neurulation, suggesting coordinated spatial regulation

    • This pattern is likely essential for establishing proper RA gradients during embryonic development

  • Functional regulation:

    • The enzymatic activity of Dhrs3 may be regulated by protein-protein interactions

    • Substrate availability (atRAL) influences Dhrs3 activity levels

    • Potential post-translational modifications may affect enzyme function

Research approaches to studying these regulatory mechanisms should include promoter analysis, chromatin immunoprecipitation (ChIP) assays, and protein interaction studies to identify transcription factors and binding partners that modulate Dhrs3 expression and activity.

How can contradictory results in Dhrs3 functional studies be reconciled?

Contradictory results in Dhrs3 research may arise from several factors:

  • Species-specific differences:

    • While Dhrs3 function appears conserved across vertebrates, subtle differences in its regulation or activity may exist between species

    • Researchers should explicitly compare results across models (Xenopus, zebrafish, mouse) to identify conserved versus divergent aspects

  • Context-dependent effects:

    • Dhrs3 function may vary depending on developmental stage, tissue type, or physiological state

    • Experimental design should control for these variables by using stage-specific manipulations and tissue-specific analyses

  • Dosage sensitivity:

    • RA signaling exhibits strong dosage sensitivity, and Dhrs3 overexpression produces dose-dependent posterior truncation effects

    • Quantitative analysis using graded concentrations of Dhrs3 constructs or morpholinos can help characterize dosage thresholds

  • Compensatory mechanisms:

    • Other enzymes in the RA pathway may compensate for Dhrs3 alteration

    • Combined knockdown/overexpression experiments targeting multiple pathway components can reveal redundancies

When analyzing contradictory results, researchers should systematically evaluate these factors and employ multiple complementary approaches (e.g., pharmacological inhibition, genetic manipulation, and biochemical assays) to triangulate the true function of Dhrs3.

What molecular markers can assess Dhrs3-mediated changes in retinoic acid signaling?

Several molecular markers can effectively monitor alterations in RA signaling resulting from Dhrs3 manipulation:

Marker TypeExamplesRegion/ProcessResponse to RA Changes
Hindbrain patterning genesen2, krox20, hoxb3Midbrain/hindbrainPosterior shift with decreased RA; anterior shift with increased RA
Homeobox geneshoxd1, gbx2Anteroposterior axisUpregulated by increased RA; downregulated by decreased RA
Caudal-related genescdx4Posterior developmentExpression level correlates positively with RA signaling
Pronephros markerslhx1, wt-1, ptegKidney developmentExpansion with increased RA; suppression with decreased RA

When designing experiments to assess Dhrs3 function, these markers should be analyzed using quantitative RT-PCR, whole-mount in situ hybridization, or RNA sequencing to provide comprehensive assessment of signaling alterations. Combining multiple markers across different developmental domains offers the most robust evaluation of how Dhrs3 manipulation affects RA-dependent patterning events.

What are the potential roles of Dhrs3 beyond embryonic development?

While current research has focused primarily on Dhrs3's role in embryonic development, its function in adult tissues and pathological conditions warrants investigation:

  • Stem cell differentiation:

    • Given RA's importance in cellular differentiation, Dhrs3 likely plays a role in adult stem cell maintenance and differentiation

    • Researchers should investigate Dhrs3 expression and function in various stem cell niches

  • Cancer biology:

    • Altered retinoid signaling is implicated in multiple cancer types

    • Studies examining Dhrs3 expression in tumors and its potential role as a tumor suppressor or oncogene would be valuable

  • Metabolic regulation:

    • As a regulator of vitamin A metabolism, Dhrs3 may influence broader metabolic processes

    • Research connecting Dhrs3 to energy homeostasis, lipid metabolism, or insulin sensitivity could reveal novel functions

  • Regenerative processes:

    • RA signaling contributes to tissue regeneration in multiple organs

    • Determining whether Dhrs3 modulation could enhance regenerative capacity represents an important research direction

Investigating these potential roles requires developing tissue-specific and inducible Dhrs3 knockout models, as well as targeted overexpression systems, to dissect its function beyond early development.

What biochemical approaches can determine the substrate specificity of recombinant mouse Dhrs3?

Comprehensive characterization of Dhrs3 substrate specificity requires multiple biochemical approaches:

  • Enzyme kinetics analysis:

    • Purified recombinant Dhrs3 should be tested with various retinoid substrates (atRAL, 9-cis-retinal, 13-cis-retinal)

    • Determining Km and Vmax values for each substrate will quantify relative preferences

    • Cofactor requirements (NAD+/NADP+) should be systematically evaluated

  • Site-directed mutagenesis:

    • Targeted mutations in the putative substrate-binding pocket can identify critical residues

    • Comparison with other SDR family enzymes can guide selection of residues for mutation

    • Altered substrate preferences resulting from mutations would provide insight into specificity determinants

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM structures of Dhrs3 with bound substrates/cofactors

    • Homology modeling based on related SDR enzymes with known structures

    • Molecular dynamics simulations to predict substrate interactions

  • Metabolomics profiling:

    • Untargeted metabolomics in systems with Dhrs3 overexpression or knockdown

    • Identifying metabolites that accumulate or decrease can reveal unexpected substrates

    • Stable isotope labeling to track metabolic flux through Dhrs3-dependent pathways

These approaches would address the current gap in understanding of Dhrs3's biochemical specificity, which the search results indicate is an area requiring further investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.