Recombinant Mouse Short-chain dehydrogenase/reductase family 42E member 1 (Sdr42e1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
Sdr42e1; Short-chain dehydrogenase/reductase family 42E member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-394
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Sdr42e1
Target Protein Sequence
MDSPRFPEETVLITGGGGYFGFRLGCALNQKGARVILFDITQPAQNLPEGIKFVCGDIRC LADVETAFQDAEKVACVFHVASYGMSGREQLNKTQIEEVNVGGTENILRACLERGVPRLV YTSTFNVIFGGQVIRNGDESLPYLPLHLHPDHYSRTKSIAEKKVLEANGLAFKQGDGILR TCAIRPAGIYGAGEQRHLPRIVSYIERGLFRFVYGDPQSLVEFVHVDNLAKAHILASEAL KADKGHVASGQPYFISDGRPVNNFEFFRPLVEGLGYTFPSTRLPLTLIYCLAFLVEMTHF IVGRLYNFQPFLTRTEVYKTGVTHYFSLEKAKKELGFEPQPFDLQEVVEWFKAHGHGRGA AGQDSEFMLWDGILILLLALSVLTWILPSTTLSI
Uniprot No.

Target Background

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization and expression pattern of mouse Sdr42e1?

Mouse Sdr42e1 belongs to the "extended" family of short-chain dehydrogenases/reductases (SDRs) superfamily of enzymes. Phylogenetic analysis has revealed that human SDR42E1 exhibits high evolutionary conservation across nematodes and fruit flies, suggesting similar genomic structures likely exist in mice . Research on human SDR42E1 demonstrates pronounced expression in skin keratinocytes and HaCat cell lines .

For mouse expression profiling, researchers should implement:

  • Tissue-specific RT-PCR across multiple organs

  • In situ hybridization for spatial distribution mapping

  • RNA-seq for comprehensive transcriptomic profiling

  • Immunohistochemistry with validated antibodies

Based on human data extrapolation, significant expression would be expected in skin tissues, correlating with vitamin D synthesis pathways.

What experimental approaches should be used to characterize mouse Sdr42e1 protein function?

Comprehensive functional characterization requires multiple complementary approaches:

  • Recombinant protein expression and purification

  • Enzyme activity assays using potential substrates (vitamin D compounds, steroid precursors)

  • Site-directed mutagenesis of predicted catalytic residues

  • Subcellular localization studies (immunofluorescence, fractionation)

  • Protein-protein interaction analysis (co-immunoprecipitation, proximity labeling)

Human SDR42E1 studies suggest potential 3-beta-hydroxy-delta5-steroid dehydrogenase activity based on typical HSD3β domains . Therefore, activity assays should evaluate metabolism of compounds such as pregnenolone to progesterone and DHEA to androstenedione. Molecular docking studies indicate strong binding affinities between human SDR42E1 and vitamin D3 and essential precursors like 8-dehydrocholesterol and 7-dehydrocholesterol .

What are the predicted structural features of mouse Sdr42e1?

While crystal structures remain unavailable, computational approaches suggest several important structural elements:

  • Classic SDR fold with Rossmann-fold for NAD(P)-binding

  • Conserved tyrosine and lysine residues in the catalytic tetrad

  • Hydrophobic regions consistent with predicted transmembrane localization

  • Binding pocket accommodating vitamin D compounds and steroid precursors

Human SDR42E1 studies identified critical residues such as tyrosine 142 and glutamine 131 that facilitate binding affinities to vitamin D compounds . Researchers should identify the corresponding residues in mouse Sdr42e1 through sequence alignment and validate their importance through mutagenesis studies.

How should CRISPR/Cas9 strategies be optimized for generating Sdr42e1 knockout mouse models?

Based on successful approaches used in human cell studies , researchers should:

  • Design multiple guide RNAs targeting conserved exons encoding catalytic domains

  • Implement comprehensive validation protocols including:

    • Genotyping (PCR, sequencing)

    • Transcript analysis (RT-PCR, RNA-seq)

    • Protein verification (Western blot, immunohistochemistry)

    • Functional validation (metabolite profiling)

To maximize efficiency:

  • Target early exons to disrupt protein function completely

  • Generate both constitutive and conditional knockouts using tissue-specific Cre recombinase systems

  • Create homozygous and heterozygous models to assess gene dosage effects

Researchers should monitor phenotypic changes related to vitamin D metabolism, cholesterol levels, and steroid hormone synthesis based on the established links between human SDR42E1 and these pathways .

What multi-omics strategy would best elucidate Sdr42e1 function in mouse models?

An integrated multi-omics approach, similar to that employed for human SDR42E1 , should include:

Transcriptomics:

  • Comparative RNA-seq of tissues from wild-type and knockout mice

  • Time-course analysis during development and under vitamin D challenge

  • Single-cell RNA-seq for cell-type specific responses

Proteomics:

  • Global proteome profiling with special attention to:

    • Vitamin D metabolizing enzymes

    • Steroid biosynthesis pathway components

    • Cholesterol metabolism proteins

  • Phosphoproteomics to identify altered signaling networks

Metabolomics:

  • Targeted analysis of vitamin D metabolites

  • Comprehensive steroid hormone profiling

  • Cholesterol and precursor measurements, particularly 7-dehydrocholesterol

Data Integration ApproachKey ParametersExpected Outcomes
Pathway enrichment analysisFDR < 0.05, minimum 5 genes per pathwayIdentification of disrupted metabolic networks
Co-expression network analysisCorrelation threshold ≥ 0.7Discovery of Sdr42e1 functional modules
Multi-omics factor analysisComponents explaining ≥ 80% varianceIntegration of transcriptomic and metabolomic signatures

How can molecular docking be applied to identify potential Sdr42e1 substrates?

Based on established approaches for human SDR42E1 , researchers should:

  • Generate high-quality homology models using multiple templates

  • Validate models through Ramachandran plot analysis and RMSD calculations

  • Perform molecular dynamics simulations to refine binding pocket conformations

  • Conduct docking simulations with:

    • Vitamin D metabolites (vitamin D3, 25-hydroxyvitamin D)

    • Steroid precursors (7-dehydrocholesterol, 8-dehydrocholesterol)

    • Cholesterol derivatives and intermediates

Human SDR42E1 showed strong binding affinities (indicated by more negative binding energies) with vitamin D3 and 8-dehydrocholesterol , suggesting these should be priority candidates for mouse Sdr42e1 as well. Hydrophobic interactions between protein residues and vitamin D compounds support the predicted transmembrane localization of the protein .

How does Sdr42e1 integrate into the vitamin D metabolism pathway?

Human SDR42E1 appears to play a crucial role in vitamin D biosynthesis . For mouse models, researchers should:

  • Map the complete vitamin D synthetic pathway in mouse tissues

  • Determine where Sdr42e1 functions within this pathway

  • Assess metabolic flux using isotope-labeled precursors

  • Measure accumulation of 7-dehydrocholesterol in knockout models, as observed in human studies

Transcriptomic analysis of human SDR42E1-depleted cells revealed significant disruption of the steroid biosynthesis pathway (1.6-fold, P = 0.03) and alterations in genes involved in vitamin D synthesis . This suggests mouse Sdr42e1 likely occupies a similar regulatory position.

What specific role does Sdr42e1 play in steroid hormone biosynthesis?

Human SDR42E1 contains typical HSD3β domains that could confer enzymatic activity partially or fully redundant with other HSD3β enzymes . Researchers should investigate:

  • Enzymatic activity on steroid hormone precursors

  • Metabolism of pregnenolone to progesterone

  • Conversion of DHEA to androstenedione

  • Compensatory mechanisms in Sdr42e1 knockout models

Human SDR42E1 has been speculated to regulate progesterone synthesis , providing a starting point for mouse investigations. Mutations in human SDR42E1 have been associated with reproductive abnormalities including micropenis, hypospadias, and cryptorchidism , supporting its role in steroidogenesis.

How does disruption of Sdr42e1 affect global gene expression patterns?

Human SDR42E1 depletion studies revealed significant alterations in multiple genes . Mouse researchers should:

  • Conduct comprehensive RNA-seq comparing wild-type and knockout tissues

  • Focus analysis on:

    • Vitamin D responsive genes

    • Steroid biosynthesis pathway components

    • Cholesterol metabolism enzymes

Key genes to monitor based on human studies include:

  • Upregulated genes: SERPINB2 (P = 2.17E−103), EBP (P = 2.46E−13), DHCR7 (P = 8.03E−09)

  • Downregulated genes: ALPP (P < 2.2E−308), SLC7A5 (P = 1.96E−215), CYP26A1 (P = 1.06E−08)

What insights does evolutionary conservation of Sdr42e1 provide for functional studies?

Phylogenetic analysis has demonstrated high evolutionary conservation of human SDR42E1 across species , suggesting fundamental biological importance. For mouse Sdr42e1 research, this conservation implies:

  • Core enzymatic functions likely preserved across species

  • Key structural domains maintained throughout evolution

  • Critical catalytic residues highly conserved

  • Potential for cross-species functional complementation

Identifying the most conserved regions through comparative genomics can guide:

  • Design of targeted mutations for functional studies

  • Development of specific antibodies and probes

  • Selection of experimental models for translational research

How do functional differences between mouse Sdr42e1 and human SDR42E1 impact translational studies?

When designing translational studies, researchers should:

  • Conduct detailed sequence and structure comparisons between orthologs

  • Identify species-specific differences in:

    • Substrate specificity

    • Enzymatic efficiency

    • Tissue expression patterns

    • Regulatory mechanisms

  • Validate findings across species using:

    • Parallel functional assays with both orthologs

    • Cross-species complementation studies

    • Humanized mouse models where appropriate

Human studies have identified specific mutations with clinical significance (e.g., p.Arg154Gln) , providing targets for equivalent mutations in mouse models to assess functional conservation.

What pathological phenotypes are associated with Sdr42e1 dysfunction?

Based on human SDR42E1 mutation findings , mouse models should be evaluated for:

  • Vitamin D deficiency manifestations

  • Connective tissue abnormalities (skin, cornea)

  • Skeletal development issues

  • Reproductive system defects

  • Cholesterol metabolism disorders

Human studies identified a homozygous missense mutation in SDR42E1 (p.Arg154Gln) associated with an oculocutaneous genital syndrome characterized by:

  • Corneal thinning and keratoconus

  • Blue sclera

  • Skin hyperelasticity

  • Joint hypermobility

  • Reproductive abnormalities

  • Low cholesterol levels

These findings provide a framework for phenotypic assessment of mouse models.

How can Sdr42e1 mouse models contribute to therapeutic development?

Mouse models of Sdr42e1 dysfunction could facilitate:

  • Preclinical testing of vitamin D supplementation strategies

  • Screening of compounds that modulate enzyme activity

  • Evaluation of tissue-specific interventions

  • Assessment of gene therapy approaches

  • Testing of small molecules targeting specific steps in the vitamin D biosynthesis pathway

Human SDR42E1 research suggests its potential as a therapeutic target for vitamin D deficiency , and mouse models provide essential in vivo systems for validating such approaches before clinical translation.

What are the most relevant biomarkers for monitoring Sdr42e1 function in experimental models?

Based on human SDR42E1 research , key biomarkers should include:

Primary biomarkers:

  • Serum 25-hydroxyvitamin D levels

  • 7-dehydrocholesterol concentration in skin and serum

  • Total cholesterol profile

  • Specific steroid hormones (particularly progesterone and androstenedione)

Secondary biomarkers:

  • Expression of vitamin D-responsive genes

  • Calcium and phosphate homeostasis

  • Connective tissue integrity markers

  • Reproductive hormone profiles

Human studies showed accumulation of 7-dehydrocholesterol when SDR42E1 was depleted , suggesting this metabolite would be a particularly valuable biomarker in mouse models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.