Recombinant Mouse Sideroflexin-4 (Sfxn4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Sideroflexin-4 (SFXN4)

Recombinant Mouse Sideroflexin-4 (SFXN4) is a bioengineered protein derived from the Sfxn4 gene in mice. It belongs to the sideroflexin family of transmembrane proteins localized to the inner mitochondrial membrane. Originally identified as a mitochondrial amino-acid transporter, SFXN4 has diverged evolutionarily to serve specialized roles in mitochondrial complex I assembly and oxidative phosphorylation . This recombinant form is produced in controlled laboratory environments for research and therapeutic development, leveraging mammalian cells or bacterial systems for expression .

Functional Roles in Mitochondrial Biology

SFXN4’s recombinant form is critical for studying its role in mitochondrial respiration and disease mechanisms:

Mitochondrial Complex I Assembly

SFXN4 interacts with the mitochondrial complex I assembly intermediate (MCIA) complex to facilitate the incorporation of the mtDNA-encoded ND6 subunit into the ND2 module of complex I . This process is vital for:

  • Electron transport chain efficiency: Loss of SFXN4 disrupts complex I assembly, reducing ATP production and oxygen consumption rates .

  • Mitochondrial disease modeling: Mutations in SFXN4 are linked to combined oxidative phosphorylation deficiency (COXPD18) and macrocytic anemia .

Role in Hepatocellular Carcinoma (HCC)

Recombinant SFXN4 is exploited to investigate its oncogenic potential in HCC:

  • Overexpression: Elevated SFXN4 correlates with poor prognosis, tumor progression, and immune infiltration .

  • Mechanistic Insights: Knockdown studies reveal SFXN4 regulates oxidative phosphorylation, reactive oxygen species (ROS), and cancer pathways (e.g., MMP2/cyclin D1) .

Research Applications and Findings

Recombinant SFXN4 is utilized in diverse experimental frameworks:

ApplicationKey FindingsSource
Complex I DeficiencySFXN4 knockout cells show isolated complex I defects, impaired respiration, and glycolytic dependency .
HCC ProliferationSFXN4 knockdown inhibits HCC cell growth (CCK-8/EdU assays) and tumor xenograft formation .
Metabolic Pathway AnalysisEnriched in oxidative phosphorylation and one-carbon metabolism pathways .
Immune ModulationSFXN4 expression correlates with immune infiltration (e.g., T-cell/DC subsets) in HCC .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Sfxn4; Sideroflexin-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Sfxn4
Target Protein Sequence
MEPNLQFWISERQAFFRRFCQWMDLLDPVNMFISIGSIEKSRQLLFTTEDAPKHYLDNQV IKDAWNKSLSTVHPDSSKLIPHLFRPAAFLPVTAPMVFLLMMPDTGIKSIILTQGCLYGY TTAFNITNGNASYSHGPVERTLLGAGVSVSSTFIGLIPHLFQMKYPPNNFWLKRTLPIVF LAQVSGMNVFASRSFENHRGIEVMDKEGHVVGHSRKAGRKAIKDTAKSRAVLFGTSALAP ELFIHIFKRTRFYPQTLLSLVILRMSSTFFMMGLMVPVSFSMFPQIGQIQCSQLEEKIQS STEEKELFYYRGV
Uniprot No.

Target Background

Function
Recombinant Mouse Sideroflexin-4 (Sfxn4) is a mitochondrial amino-acid transporter. It does not function as a serine transporter and cannot mediate serine transport into mitochondria.
Database Links
Protein Families
Sideroflexin family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Largely restricted to kidney, brain and heart.

Q&A

What is Sideroflexin-4 (Sfxn4) and what are its primary functions?

Sfxn4 is a member of the Sideroflexin (SFXN) family, which consists of five mitochondrial membrane proteins (SFXN1-5). These proteins span the inner mitochondrial membrane with a structure typical of solute carrier (SLC) proteins, containing five transmembrane helices. Sfxn4 specifically functions as a co-factor for the assembly of mitochondrial complex I and plays crucial roles in iron metabolism and mitochondrial function . Research has identified Sfxn4 as a critical component involved in iron-sulfur (Fe-S) cluster biogenesis, which is essential for numerous cellular processes including DNA repair, protein synthesis, and energy production . Unlike other SFXN family members that primarily function as amino acid transporters, Sfxn4 appears to have evolved distinct functions related to mitochondrial complex assembly and Fe-S cluster formation, suggesting a dramatic functional shift through evolution .

How does Sfxn4 differ from other members of the Sideroflexin family?

While all Sideroflexin family members (SFXN1-5) share structural similarities with mitochondrial tricarboxylate carrier domains, they exhibit distinct functional profiles. Sfxn4 is uniquely identified as a co-factor for mitochondrial complex I assembly, whereas SFXN1 is primarily associated with iron transport and sideroblastic anemia . SFXN2 is involved in amino acid transport and oxidative phosphorylation, while SFXN3 transports serine into mitochondria, playing a key role in folate-mediated one-carbon metabolism . Unlike SFXN1 and SFXN3, which show pronounced expression in specific tissues like developing red blood cells and brain tissue respectively, Sfxn4 demonstrates broader expression patterns and has been particularly implicated in cancer biology through its role in Fe-S cluster biogenesis . Mutations in Sfxn4 have been linked to mitochondrial diseases, whereas SFXN3 mutations are associated with neurodegenerative disorders, highlighting their distinct pathological impacts .

What experimental approaches are commonly used to study recombinant Sfxn4 expression?

Researchers typically employ several complementary approaches to study recombinant Sfxn4. The most common method involves cloning the mouse Sfxn4 gene into expression vectors with appropriate tags (His, FLAG, or GFP) for purification and detection. Expression systems include prokaryotic (E. coli) for basic structural studies and eukaryotic systems (mammalian cells, particularly HEK293 or mouse cell lines) for functional studies that require proper post-translational modifications . For quantitative analysis of Sfxn4 expression, enzyme-linked immunosorbent assay (ELISA) is frequently utilized, with commercially available kits capable of detecting mouse Sfxn4 in the range of 0.156-10 ng/ml in tissue homogenates, cell lysates, and biological fluids . When analyzing subcellular localization, immunofluorescence microscopy with mitochondrial co-localization markers (such as MitoTracker) is essential to confirm proper targeting to the inner mitochondrial membrane . Western blotting using specific anti-Sfxn4 antibodies serves as a standard verification method for expression levels and protein size.

What are the optimal conditions for expressing and purifying recombinant mouse Sfxn4?

Expressing and purifying functional recombinant mouse Sfxn4 requires careful optimization due to its mitochondrial membrane protein nature. For bacterial expression systems, using E. coli BL21(DE3) with reduced expression temperature (16-18°C) after IPTG induction (0.1-0.5 mM) minimizes inclusion body formation. The addition of 1% glucose to the media helps suppress basal expression before induction . For eukaryotic expression, mammalian systems like HEK293 cells provide better post-translational modifications and proper folding. Using synthetic codon-optimized sequences improves expression efficiency, while adding a C-terminal rather than N-terminal tag prevents interference with mitochondrial targeting signals. Purification is optimally performed using mild detergents (0.5-1% DDM or 1-2% digitonin) to solubilize the protein without denaturing its structure . A two-step purification approach combining immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography yields the highest purity preparations. Throughout purification, maintaining buffers at pH 7.2-7.4 with 150-300 mM NaCl and including 10% glycerol significantly improves protein stability. Storage at -80°C in small aliquots prevents repeated freeze-thaw cycles that can compromise protein integrity.

How can researchers verify the functional activity of recombinant Sfxn4 in experimental settings?

Verifying functional activity of recombinant Sfxn4 requires multiple complementary approaches. First, researchers should confirm proper mitochondrial localization using subcellular fractionation and western blotting with mitochondrial markers (such as VDAC or COX IV) or fluorescence microscopy with mitochondrial co-staining if using tagged constructs . For direct functional assessment, complex I assembly assays measuring NADH:ubiquinone oxidoreductase activity in control versus Sfxn4-deficient cells reconstituted with the recombinant protein provide functional evidence of complex I co-factor activity . Alternatively, iron-sulfur (Fe-S) cluster biogenesis can be assessed by measuring the activities of Fe-S-dependent enzymes like aconitase and complexes I, II, and III of the electron transport chain in cells with manipulated Sfxn4 levels . Researchers should also quantify the labile iron pool using fluorescent indicators like calcein-AM, as Sfxn4 dysfunction leads to iron accumulation . Additionally, induction of oxidative stress markers (increased ROS levels, lipid peroxidation, or glutathione depletion) and DNA damage response activation (phosphorylation of H2AX) after Sfxn4 knockdown followed by rescue with recombinant protein provides evidence of functional activity in cellular contexts .

What are the critical factors to consider when designing Sfxn4 knockout or knockdown experiments?

When designing Sfxn4 knockout or knockdown experiments, several critical factors must be considered to ensure valid results. First, researchers must select the appropriate genetic modification approach: CRISPR/Cas9 provides complete knockout but may trigger compensatory mechanisms, while siRNA or shRNA approaches allow for temporary and partial knockdown that may better mimic therapeutic intervention scenarios . Verification of knockout/knockdown efficiency requires both protein-level (western blot) and functional assessment (measuring complex I activity and Fe-S cluster-dependent enzyme activities) to confirm the biological impact extends beyond mere protein reduction . Including rescue experiments with wild-type Sfxn4 is essential to confirm phenotypes are specifically due to Sfxn4 deficiency rather than off-target effects. Researchers must consider potential confounding by compensatory upregulation of other Sideroflexin family members (particularly SFXN1) in response to Sfxn4 depletion, necessitating assessment of all family members . The timing of analysis is crucial, as acute versus chronic Sfxn4 deficiency may yield dramatically different phenotypes due to adaptive responses. Finally, the specific cell type must be carefully selected, as the dependence on Sfxn4 varies significantly between tissues, with rapidly dividing cancer cells showing particular sensitivity to Sfxn4 inhibition compared to normal cells .

How does Sfxn4 contribute to cancer progression and drug resistance mechanisms?

Sfxn4 contributes to cancer progression through multiple mechanisms centered on its role in iron-sulfur (Fe-S) cluster biogenesis. In ovarian cancer cells, Sfxn4 supports the function of critical Fe-S-dependent DNA repair enzymes, including those involved in homologous recombination and nucleotide excision repair pathways . This enhanced DNA repair capacity allows cancer cells to resist DNA-damaging chemotherapeutic agents like cisplatin. Through its mitochondrial functions, Sfxn4 also supports metabolic adaptation in cancer cells by maintaining electron transport chain integrity, particularly complex I assembly, facilitating the high energy demands of rapidly proliferating tumor cells . Research has demonstrated that Sfxn4 knockdown in ovarian cancer cells significantly increases their sensitivity to both platinum-based chemotherapeutics and PARP inhibitors, even in previously resistant cell lines . This sensitization occurs through a dual mechanism: first, inhibition of Fe-S biogenesis triggers accumulation of excess iron, leading to oxidative stress; second, DNA repair enzymes that require Fe-S clusters for their function are inhibited, compromising multiple DNA repair pathways simultaneously . These findings position Sfxn4 as a potential therapeutic target, particularly in cancers reliant on enhanced DNA repair mechanisms for survival and drug resistance.

What is the relationship between Sfxn4 mutations and mitochondrial diseases?

Sfxn4 mutations have been implicated in mitochondrial diseases through its critical role as a co-factor for the assembly of mitochondrial complex I, a key component of the electron transport chain . Pathogenic mutations in the Sfxn4 gene can lead to disorders characterized by defective iron incorporation and mitochondrial dysfunction. While not directly linked to sideroblastic anemia like SFXN1, Sfxn4 dysfunction results in conditions with overlapping clinical presentations involving disrupted energy metabolism . Mechanistically, Sfxn4 mutations impair iron-sulfur (Fe-S) cluster biogenesis, affecting multiple mitochondrial processes beyond complex I assembly. This includes disturbances in mitochondrial iron homeostasis, respiratory chain complex formation, and cellular redox balance . These disruptions manifest clinically as features typical of mitochondrial disorders, including muscle weakness, exercise intolerance, developmental delays, and multisystem involvement. Genome-wide association studies have also linked SFXN4 gene variants to increased risk of ischemic stroke, particularly in individuals of African ancestry, suggesting its potential role in cerebrovascular pathologies . The growing body of evidence indicates that Sfxn4 dysfunction represents an important mechanism in a subset of mitochondrial diseases, particularly those featuring defects in iron metabolism and respiratory chain function.

How does post-translational modification regulate Sfxn4 function in different physiological contexts?

Post-translational modifications (PTMs) of Sfxn4 represent an understudied yet potentially critical regulatory mechanism that modulates its function across different physiological contexts. Analysis of large-scale proteomic datasets has revealed that Sfxn4 undergoes multiple PTMs, including phosphorylation, acetylation, and ubiquitination at conserved residues . Phosphorylation of Sfxn4 appears particularly important during cellular stress responses, with evidence suggesting that stress-activated kinases modify Sfxn4 to alter its stability or interactions with complex I assembly factors . In cancer cells, hyperphosphorylation of Sfxn4 correlates with increased protein stability and enhanced Fe-S cluster biogenesis, potentially contributing to chemoresistance mechanisms . Acetylation states of Sfxn4 likely respond to cellular metabolic status, as mitochondrial protein acetylation is intimately linked to acetyl-CoA availability, potentially creating a feedback loop between Sfxn4 function and cellular metabolic state . Under oxidative stress conditions, Sfxn4 shows increased ubiquitination, suggesting a potential quality control mechanism to remove damaged protein . Research utilizing site-directed mutagenesis of key PTM sites has demonstrated that these modifications can significantly alter Sfxn4's subcellular localization, protein-protein interaction network, and functional activity in Fe-S cluster biogenesis. The dynamic interplay between different PTMs likely creates a sophisticated regulatory network that fine-tunes Sfxn4 function according to specific cellular needs and environmental conditions.

What are the structural determinants of Sfxn4 that distinguish its function from other Sideroflexin family members?

The structural determinants that differentiate Sfxn4 from other Sideroflexin family members remain incompletely characterized but offer key insights into its specialized functions. All SFXN proteins share a common architecture with five transmembrane helices spanning the inner mitochondrial membrane, but Sfxn4 contains unique amino acid residues within its transmembrane domains that are thought to facilitate specific interactions with iron or iron-containing molecules . Comparative sequence analysis reveals that Sfxn4 has distinct conserved motifs in its intermembrane space loops that likely mediate specific protein-protein interactions with complex I assembly factors, a function not shared by other family members . The C-terminal domain of Sfxn4 contains a unique pattern of charged residues that may create an electrostatic environment favorable for Fe-S cluster transfer or assembly . Structural modeling suggests that Sfxn4's substrate-binding pocket has a unique geometry compared to other SFXN proteins, potentially explaining its specialized role in complex I assembly rather than direct amino acid transport . Additionally, Sfxn4 contains distinctive cysteine residues not conserved in other family members that may participate in redox sensing or directly in Fe-S cluster coordination . These structural features collectively contribute to Sfxn4's specialized functions and may explain why mutations in Sfxn4 result in distinct pathological outcomes compared to mutations in other SFXN family members .

How can researchers accurately measure the impact of Sfxn4 on iron-sulfur cluster biogenesis?

Accurately measuring Sfxn4's impact on iron-sulfur (Fe-S) cluster biogenesis requires a multi-faceted approach incorporating both direct and indirect methodologies. The most direct measurement involves quantifying 55Fe incorporation into Fe-S proteins following metabolic labeling in cells with modified Sfxn4 expression, allowing for tracking of newly synthesized Fe-S clusters . This should be complemented by enzymatic activity assays of Fe-S-dependent enzymes such as aconitase (mitochondrial and cytosolic forms), which rapidly lose activity when Fe-S cluster synthesis is compromised . Researchers should assess multiple Fe-S-dependent proteins spanning different cellular compartments, as Sfxn4 may preferentially affect certain Fe-S protein subsets . Electron paramagnetic resonance (EPR) spectroscopy provides a more direct measure of Fe-S cluster integrity within proteins, though it requires specialized equipment . Measurement of the labile iron pool using fluorescent indicators like calcein-AM provides crucial indirect evidence, as disrupted Fe-S biogenesis typically results in iron accumulation . Additionally, assessing the protein levels and assembly state of key components in the Fe-S cluster biogenesis machinery (IscU, ISCU, frataxin, etc.) can reveal compensatory responses to Sfxn4 dysfunction . For comprehensive analysis, researchers should examine the effects under various stress conditions (oxidative stress, iron limitation) as well as in different cellular compartments, as Sfxn4's role may be particularly important under specific cellular states .

What experimental design approaches can best evaluate Sfxn4 as a therapeutic target?

Designing experiments to evaluate Sfxn4 as a therapeutic target requires a comprehensive approach that spans from molecular to organismal levels. Initial validation should include correlation studies assessing Sfxn4 expression across disease tissue samples compared to normal counterparts, with particular attention to associations with clinical outcomes and treatment response . For target validation, researchers should employ multiple complementary approaches to modulate Sfxn4, including genetic (CRISPR/Cas9, RNAi) and pharmacological methods if available, comparing acute versus chronic inhibition effects . Cellular phenotyping should comprehensively assess both on-target effects (complex I assembly, Fe-S cluster formation) and anticipated therapeutic effects (sensitization to DNA-damaging agents, altered cellular metabolism) . Resistance mechanisms must be proactively investigated by analyzing adaptive responses to Sfxn4 inhibition, including compensatory upregulation of other Sideroflexin family members or alternative Fe-S biogenesis pathways . In vivo evaluation requires careful model selection—xenograft models using cell lines with manipulated Sfxn4 expression provide initial validation, while genetically engineered mouse models with tissue-specific Sfxn4 deletion more accurately reflect therapeutic contexts . Combination studies with established therapeutics are essential, particularly for cancer applications where Sfxn4 inhibition synergizes with DNA-damaging agents and PARP inhibitors . Throughout development, researchers must rigorously assess potential toxicity in high-risk tissues (heart, brain, liver) due to the fundamental role of Fe-S clusters in cellular metabolism, including defining therapeutic windows where disease cells show greater sensitivity than normal tissues .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.