Recombinant Mouse Signal peptidase complex subunit 2 (Spcs2)

Shipped with Ice Packs
In Stock

Description

Role in Signal Peptide Processing

SPCS2 is essential for the enzymatic activity of the SPC, enabling precise cleavage of signal peptides during cotranslational translocation . Defects in SPCS2 disrupt protein targeting, leading to misfolded proteins in the ER .

Quality Control in Membrane Proteome

Recent studies highlight SPCS2’s role in identifying and degrading faulty membrane proteins. The human SPC (which includes SPCS2 homologs) cleaves misfolded substrates, preventing their accumulation and maintaining membrane integrity . This dual function—processing and quality control—is likely conserved in mouse models.

Experimental Uses

ApplicationDescriptionSource
In Vitro StudiesInvestigating SPC assembly and signal peptide cleavage kinetics
ELISAQuantifying SPCS2 levels in mouse tissues or cell lysates (e.g., using kits from Abbexa)
Drug DiscoveryScreening modulators of SPC activity for therapeutic applications

Research Findings and Disease Relevance

  • Protein Quality Control: The SPC’s ability to degrade misfolded proteins suggests therapeutic potential for neurodegenerative diseases linked to protein misfolding .

  • Membrane Protein Biogenesis: SPCS2 knockout models reveal disrupted ER protein translocation, underscoring its role in cellular homeostasis .

  • Species-Specific Insights: Recombinant mouse SPCS2 facilitates cross-species comparative studies, aiding in understanding evolutionary conservation of ER processes .

Challenges and Future Directions

  • Structural Complexity: The multi-pass transmembrane nature of SPCS2 complicates crystallization and high-resolution structural studies.

  • Functional Redundancy: Overlapping roles with other SPC subunits may mask SPCS2-specific effects in knockout models.

  • Therapeutic Targets: Exploiting SPCS2’s quality control function for treating folding disorders remains an active area of research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Spcs2; Spc25; Signal peptidase complex subunit 2; Microsomal signal peptidase 25 kDa subunit; SPase 25 kDa subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-226
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Spcs2
Target Protein Sequence
AASASQGGRSGGGGGSSGAGGGPSCGTSSSRSGLLDKWKIDDKPVKIDKWDGSAVKNSLD DSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISY FVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRT KQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLATERKIK
Uniprot No.

Target Background

Function

Component of the microsomal signal peptidase complex. This complex removes signal peptides from nascent proteins during their translocation into the endoplasmic reticulum lumen.

Database Links
Protein Families
SPCS2 family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the functional significance of Spcs2 in the signal peptidase complex?

    Spcs2 is one of four evolutionarily conserved membrane subunits (Spc1-3 and Sec11) that comprise the eukaryotic signal peptidase complex. Based on studies in yeast, Spcs2 plays a crucial role in modulating substrate- and cleavage site-selection by the SPC. While not absolutely essential for signal peptide cleavage, Spcs2 significantly enhances the complex's ability to discriminate between signal peptides (SPs) and signal-anchored sequences (SAs) .

    Methodologically, researchers investigating Spcs2 function should design experiments comparing wild-type and Spcs2-depleted or mutated systems, examining the processing of both normal substrates and model substrates with systematically varied features (e.g., different n-region lengths, h-region lengths, and potential cleavage sites) .

  • How does the structure of Spcs2 contribute to its function?

    Spcs2 contains transmembrane domains and a cytosolic C-terminal domain. The C-terminal domain covers the cytosolic side of the SPC and appears to regulate substrate access based on n-region length. Additionally, polar residues within the transmembrane domains (such as tyrosine and serine residues observed in yeast Spc2) contribute to membrane thinning at the center of the SPC .

    For structural studies, researchers should consider:

    ApproachAdvantagesTechnical Considerations
    AlphaFold2-Multimer modelingProvides initial structural insightsValidate with experimental approaches
    Cryo-EMDirect visualization of the complexRequires stable, purified complexes
    Cross-linking mass spectrometryMaps interaction interfacesNeeds optimization for membrane proteins
    Molecular dynamics simulationsReveals dynamic propertiesMust be validated against experimental data
  • What expression systems are most effective for recombinant mouse Spcs2 production?

    For functional studies of mouse Spcs2, mammalian expression systems are typically preferred to ensure proper folding and interactions. Based on approaches used for yeast Spc2, an effective strategy involves:

    • Cloning mouse Spcs2 into vectors with strong promoters (e.g., CMV for mammalian cells)

    • Adding C-terminal epitope tags (HA or FLAG) for detection and purification

    • Using Gibson Assembly for construct generation

    • Considering both transient and stable expression systems

    When studying interactions with other SPC components, co-expression strategies may be necessary to facilitate complex formation. For mutation studies, site-directed mutagenesis approaches similar to those used for yeast Spc2 can be employed .

  • How can I verify successful expression and proper folding of recombinant mouse Spcs2?

    Verification of recombinant Spcs2 expression and folding requires multiple approaches:

    • Western blotting using antibodies against Spcs2 or epitope tags

    • Subcellular fractionation to confirm ER membrane localization

    • Co-immunoprecipitation assays to verify interactions with other SPC components

    • Complementation assays in cells depleted of endogenous Spcs2

    • Functional assays measuring signal peptide processing of model substrates

    Pulse-labeling experiments, as used in yeast Spc2 studies, are particularly valuable for capturing the early stages of protein maturation in the ER and assessing signal sequence processing .

  • What experimental approaches can I use to study Spcs2-substrate interactions?

    To study Spcs2-substrate interactions, researchers should consider the methods that have proven effective for yeast Spc2:

    • Co-immunoprecipitation assays to identify interacting proteins

    • Pulse-labeling with radioactive amino acids to track substrate processing

    • Construction of model substrates with systematically varied features

    • Use of catalytically inactive SPC mutants to trap substrate intermediates

    • Size exclusion chromatography to characterize Spcs2-substrate complexes

    Signal peptides appear to interact primarily with a 200 kDa Spcs2-containing complex, while preproteins are found in larger 600 kDa complexes, suggesting distinct interaction modes that can be exploited for experimental design .

Advanced Research Questions

  • How does Spcs2 modulate membrane properties to enhance substrate discrimination?

    Coarse-grained molecular dynamics (CGMD) simulations have revealed that Spcs2 induces membrane thinning at the center of the SPC, which is critical for substrate discrimination. This membrane modulation appears to be mediated by polar residues in the transmembrane domains of Spcs2 that coordinate phosphate headgroups deep within the transmembrane window .

    SPC CompositionMembrane Thickness at TM WindowEffect on Substrate Discrimination
    SPC with Spcs2Thinner (~21Å)Efficient discrimination between SPs and SAs
    SPC without Spcs2Thicker (~24Å)Reduced discrimination, increased cleavage of SAs
    SPC with Spcs2 polar residue mutationsIntermediate thickness (~22Å)Intermediate discrimination ability

    To study this phenomenon, researchers should consider:

    • CGMD simulations of mouse Spcs2 in membrane environments

    • Mutagenesis of polar residues in transmembrane domains

    • Assessment of membrane thickness and fluidity using biophysical approaches

    • Correlation of membrane properties with substrate processing efficiency

  • What is the role of the C-terminal domain of Spcs2 in substrate selection?

    The C-terminal domain of Spcs2 plays a crucial role in n-region length-dependent substrate selection. This cytosolic domain appears to regulate access of signal sequences to the SPC active site based on the length of their n-regions .

    Experimental approaches to investigate this include:

    • Construction of C-terminal truncation mutants (similar to the Spc2-ΔCD variants used in yeast studies)

    • Systematic variation of n-region length in model substrates

    • Pulse-labeling experiments to assess processing efficiency

    • In vitro binding assays to measure direct interactions

    • Structural studies of the C-terminal domain in isolation and in complex with substrates

    Research with yeast Spc2 showed that truncation of the C-terminal domain resulted in altered substrate preferences, with reduced processing of short n-region substrates and enhanced processing of long n-region substrates, similar to the phenotype observed in Spc2-deleted cells .

  • How can I design experiments to study the role of Spcs2 in cleavage site selection?

    To investigate Spcs2's role in cleavage site selection, researchers should consider the following approach based on yeast studies:

    1. Design model substrates with multiple potential cleavage sites (CS1, CS2)

    2. Systematically mutate individual cleavage sites to inactivate them

    3. Use pulse-labeling experiments to assess which sites are used in the presence or absence of Spcs2

    4. Analyze cleavage products by SDS-PAGE or mass spectrometry to determine precise cleavage positions

    5. Compare results between wild-type and Spcs2-depleted or mutated systems

    Studies in yeast have shown that Spc2 affects the choice between alternative cleavage sites, with different preferences observed in Spc2-deleted strains compared to wild-type .

  • What approaches can reveal how Spcs2 interacts with the Sec61 translocon?

    Spcs2 is known to interact with the β subunit of the Sec61 translocon in yeast and mammals, potentially coordinating protein translocation with signal peptide cleavage . To study this interaction:

    • Perform co-immunoprecipitation experiments with Spcs2 and Sec61β

    • Use crosslinking approaches to capture transient interactions

    • Employ split fluorescent protein systems to visualize interactions in living cells

    • Design peptide competition assays to map interaction interfaces

    • Create interaction-deficient mutants to assess functional consequences

    While these interactions appear to facilitate efficient processing, they are not absolutely essential, as signal peptides can be processed in the absence of Spcs2 in vivo .

  • How can I investigate the role of Spcs2 in quality control of membrane proteins?

    Spcs2 may play a role in the quality control of membrane proteins, similar to the signal peptide peptidase (SPP) which interacts with misfolded membrane proteins . To investigate this function:

    • Analyze interactions between Spcs2 and known misfolded membrane proteins

    • Characterize the composition of different Spcs2-containing complexes (200, 400, and 600 kDa)

    • Assess the fate of misfolded proteins in Spcs2-depleted cells

    • Investigate potential connections between Spcs2 and the ER-associated degradation (ERAD) machinery

    • Study the effects of Spcs2 depletion on unfolded protein response activation

    Research has shown that SPP interacts specifically with newly synthesized membrane proteins, including misfolded proteins, suggesting a quality control function that might be shared or coordinated with Spcs2 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.