Recombinant Mouse Smoothened homolog (Smo)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Constructs

Recombinant mouse Smo is typically expressed in lentiviral vectors for stable transduction in mammalian cells. Key construct details include:

  • Vector: pLTC lentivector with CMV promoter for high expression.

  • Selection Markers: Optional antibiotic resistance (e.g., puromycin) for stable cell lines .

  • Applications: Used to study Smo’s subcellular trafficking, phosphorylation, and interactions with Hh pathway components .

Construct ParameterSpecificationReference
PromoterCMV
Selection MarkerOptional (e.g., puromycin resistance)
Expression SystemHEK293 cells for lentiviral particle production

Functional Mechanisms and Signaling Pathways

Smo’s activation involves ligand-independent and -dependent mechanisms:

  • Ligand-Independent Activation: Gain-of-function mutations (e.g., SmoA1) mimic Hh signaling, driving oncogenesis .

  • Phosphorylation-Dependent Activation: Hh binding to Ptch relieves inhibition, enabling Smo phosphorylation by kinases (e.g., PKA, CKI, FU), which promotes ciliary localization and Gli transcription factor activation .

  • G-Protein Coupling: Smo directly activates heterotrimeric G proteins (e.g., Gαi), modulating cAMP levels .

Key Pathway Interactions:

  1. Hh Ligand → Ptch → Smo: Hh binding to Ptch derepresses Smo, enabling its ciliary trafficking and Gli stabilization .

  2. Smo → Gli: Phosphorylated Smo recruits EVC/EVC2 to antagonize Sufu, releasing Gli for nuclear translocation .

Subcellular Localization and Trafficking

  • Ciliary Translocation: Hh signaling induces Smo accumulation in primary cilia, a process inhibited by antagonists like cyclopamine .

  • Basal Membrane Enrichment: High Hh levels drive Smo localization to basal cell membranes via kinase-dependent phosphorylation .

Pharmacological Modulation

CompoundMechanismReference
CyclopamineBinds Smo heptahelical core, inhibiting Hh signaling
BudesonideInteracts with CRD, modulating Smo activity in Drosophila and human models
SAGAgonist that antagonizes cyclopamine, activating Smo

Disease Relevance

  • Cancer: Oncogenic SMO mutations drive basal cell carcinoma and medulloblastoma. Recombinant Smo is used to model drug resistance .

  • Hematopoiesis: Conditional knockout studies show Smo is dispensable for adult murine hematopoiesis .

Challenges and Considerations

  1. Proper Folding: CRD mutations (e.g., cysteine-to-alanine) cause ER retention, necessitating optimized expression conditions .

  2. Conformational Complexity: Smo adopts multiple active/inactive states, complicating drug design. For example, cyclopamine forces inactive conformations, while phosphorylation stabilizes active states .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Smo; Smoh; Smoothened homolog; SMO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-793
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Smo
Target Protein Sequence
AALSGNVTGPGPHSASGSSRRDVPVTSPPPPLLSHCGRAAHCEPLRYNVCLGSALPYGAT TTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQ ATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPKSWYE DVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILF YVNACFFVGSIGWLAQFMDGARREIVCRADGTMRFGEPTSSETLSCVIIFVIVYYALMAG VVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSG ICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINET MLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKKPIPDCE IKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGHSDDEPKRIKKSKM IAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFDLNEPSADVSSAWAQHVTKMVAR RGAILPQDVSVTPVATPVPPEEQANMWLVEAEISPELEKRLGRKKKRRKRKKEVCPLRPA PELHHSAPVPATSAVPRLPQLPRQKCLVAANAWGTGESCRQGAWTLVSNPFCPEPSPHQD PFLPGASAPRVWAQGRLQGLGSIHSRTNLMEAEILDADSDF
Uniprot No.

Target Background

Function
Smoothened (SMO) is a G protein-coupled receptor that likely associates with the patched protein (PTCH) to relay signals from hedgehog proteins. Binding of sonic hedgehog (SHH) to its receptor, patched, is thought to prevent the normal inhibition of smoothened (SMO) by patched. SMO is essential for the accumulation of KIF7, GLI2, and GLI3 in the cilia. It interacts with DLG5 at the ciliary base to induce the accumulation of KIF7 and GLI2 at the ciliary tip, leading to GLI2 activation.
Gene References Into Functions
  1. Identified SMO-dependent Shh signaling as a specific process for the activation of adventitial fibroblasts, subsequent proliferation of smooth muscle cells, and neointima formation. PMID: 29088375
  2. Demonstrated that cholesterol within the bilayer is sufficient for constitutive Smoothened activation. Cholesterol effects occur independently of the lipid-binding Smoothened extracellular domain, a region dispensable for Patched1-Smoothened coupling. PMID: 29229834
  3. Showed that the highest levels of vertebrate Hedgehog signaling activity require efficient Smo ciliary enrichment. PMID: 29571613
  4. Revealed that sustained Smo inhibits postnatal kidney development by suppressing the proliferation of the mesenchyme and medullary collecting ducts in mice. PMID: 28564646
  5. Demonstrated that the cytosolic phospholipase cPLA2alpha is activated through Gbetagamma downstream of Smo to release arachidonic acid. Arachidonic acid binds Smo and synergizes with CRD-binding agonists, promoting Smo ciliary trafficking and high-level signaling. PMID: 28591579
  6. Observed that cholesterol, an essential component of the cell membrane, directly binds to Smoothened and alters its shape, enabling activation of Hedgehog signaling components within cells. PMID: 27705744
  7. Found that depletion of SMO mRNA in Jurkat cells facilitated HIV-1 vector infection, suggesting that endogenous SMO plays a role in limiting lentiviral infection. These findings suggest that SMO inhibits HIV-1 replication after reverse transcription completion but before integration. PMID: 28917838
  8. Provided evidence suggesting that Ptch1/2 mediate secretion of a Smo-inhibitory cholesterol precursor. PMID: 27552050
  9. Concluded that CCRK positively regulates the kinetics by which ciliary proteins, such as Smoothened and Gli2, are imported into the cilium, and that the efficiency of ciliary recruitment allows for potent responses to Hedgehog signaling over extended periods. PMID: 28817564
  10. Demonstrated that SMO is covalently modified by cholesterol. This modification is regulated by Ptch1 and Hh and is crucial for Hh signaling. PMID: 28344083
  11. Observed that downregulation of Smo activity, using the selective Smo inhibitor cyclopamine, led to a synergistic effect with TMP, while Smo overexpression plasmid impaired the induction of antiangiogenesic effects of TMP. PMID: 28112475
  12. Identified six molecules, with IC50 values in the low micromolar range, as analogs. Notably, one of the most active new antagonists remained efficacious against the D473H mutant of Smoothened, which confers clinical resistance to the antagonist vismodegib in cancer treatment. PMID: 27490099
  13. Found that disruption of paracrine Hedgehog signaling through genetic ablation of Smoothened (Smo) in stromal fibroblasts in a Kras(G12D) mouse model increased acinar-to-ductal metaplasia PMID: 27633013
  14. Concluded that Smo and primary cilia-dependent noncanonical Hh signaling leads to post-translational regulation of microtubules, which could be important for modulating cell behaviors. PMID: 27793670
  15. Identified the Hedgehog pathway receptor SMO as a key regulator of gastric cancer paclitaxel resistance. PMID: 28350784
  16. Identified compounds with potential for treating drug-resistant SmoM2-driven cancer forms, while also revealing off-target effects of established clinical drugs. PMID: 26931153
  17. Found that SMO overexpression leads to increased susceptibility to kainate excitotoxicity and seizures in the cerebral cortex of Dach-SMO mice, due to a glutamate-releasing response to kainate from astrocyte processes, triggered by activation of Ca(2+)-permeable AMPA receptors. PMID: 26530396
  18. Observed that exogenous addition of 3beta,5alpha-dihydroxycholest-7-en-6-one, a naturally occurring B-ring oxysterol derived from 7-DHC that also accumulates in Smith-Lemli-Opitz syndrome, blocked Hedgehog signaling by inhibiting activation of the essential transduction component Smoothened, through a mechanism distinct from Smoothened modulation by other lipids. PMID: 27162362
  19. Investigated the effects of genetic loss of ephrin-A5, Eph receptors EphA4, and EphA7 on the development of medulloblastoma tumors in the smoothened (Smo) transgenic mouse model. PMID: 26345456
  20. Found that halcinonide and clobetasol act as Smoothened (Smo) agonists to up-regulate myelin gene expression and retinoid X receptor gamma (RxRgamma) activation. PMID: 26658258
  21. Provided genetic evidence for a Smoothened-Galpha(i) signaling axis in mammals. PMID: 26373671
  22. Demonstrated that activated SMO functions as a GPCR to stimulate proliferation in vivo. PMID: 26373672
  23. Observed that Hedgehog (Hh) pathway activation, either by a ligand or genetic loss of the negatively acting Hh receptor Patched-1 (Ptch), reduced the affinity and frequency of signaling protein Smoothened (Smo) binding at the base. PMID: 26100903
  24. Found that increased expression of Smo activates breast cancer stem-like cells and promotes tumorigenesis. PMID: 25451166
  25. Identified Notch signaling as a novel modulator of Shh signaling that acts mechanistically via regulation of ciliary localization of key components of its transduction machinery. PMID: 25995356
  26. Concluded that the Hedgehog pathway, including its member Smoothened, is essential during a specific embryonic period (E9.5-E12.5) in lens development to regulate lens epithelial cell proliferation, survival, and FoxE3 expression. PMID: 25268479
  27. Indicated that the bromodomain protein inhibitor I-BET151 attenuates Hedgehog signaling downstream of Smoothened protein. PMID: 25355313
  28. Proposed a bifurcation of Smo activity in Hh response, with a Dlg5-independent arm for suppressing Gli repressor formation and a second arm involving Smo interaction with Dlg5 for Gli activation. PMID: 25644602
  29. Suggested a novel miR-326-negative feedback loop in regulating the activity of Shh/Gli/Smo signaling. PMID: 24617895
  30. Found that Hrs mediates Smo trafficking in the late endosome by not only promoting Smo ubiquitination but also blocking Smo phosphorylation. PMID: 24244405
  31. Observed pancytopenic features of peripheral blood, developmental anomalies of neutrophils, depression of primitive stem and progenitor population along with Shh, Ptch1, Smo, and Gli1 expression in the aplasia group. PMID: 23152377
  32. Demonstrated that Smo interacts with ILK and is required for SHh-driven activation of Gli2 in the embryonic mouse cerebellum. PMID: 23877428
  33. Suggested that Smoothened signaling, acting through cyclin D2, is crucial for the proper development and maturation of the neocortex. PMID: 23680462
  34. Highlighted previously unrecognized effects of Shh-Smoothened signaling in region-specific neurogenesis within the ventral midbrain. PMID: 23618354
  35. Found that Hedgehog pathway activity is sensitive to lipid binding at several Smo sites, suggesting mechanisms for tuning by multiple physiological inputs. PMID: 23954590
  36. Revealed that oxysterol binding to vertebrate Smo is required for normal Hh signaling and that targeting the oxysterol-binding site is an effective strategy for inhibiting Smo. PMID: 23831757
  37. Identified SMO as a master regulator of hepatic epithelial regeneration based on its ability to promote mesenchymal-to-epithelial transitions in a subpopulation of stellate cell-derived myofibrblasts. PMID: 23563311
  38. Observed that sustained Smo activation inhibits postnatal development of bone by suppressing gene expression of bone formation regulatory factors in mice. PMID: 22983747
  39. Suggested that sustained SMO up-regulation could contribute to T-cell lymphoblastic lymphoma development and that specific SMO inhibitors or microRNAs-based therapies might be viable options for treating a significant subset of T-cell lymphoblastic lymphomas. PMID: 23288923
  40. Found that Smo translocation to the cilium was normal in Evc2-deficient chondrocytes following Hh activation with the Smo-agonist SAG. PMID: 23026747
  41. Provided data suggesting that the Smo-Evc2 signaling complex at the EvC zone is essential for Hh signal transmission and shed light on the molecular basis of two human ciliopathies. PMID: 22981989
  42. Indicated that STAT3 knockout reduces SmoM2-mediated carcinogenesis. PMID: 22992748
  43. Proposed that altered subcellular localization of the transducer Smoothened, which functions in both the canonical and noncanonical pathways, is responsible for eliciting distinct Hedgehog (Hh) outputs. PMID: 22912492
  44. Demonstrated that smoothened (Smo) mutants unable to localize to the primary cilium preferentially mediate Hedgehog (Hh) chemotaxis. PMID: 22912493
  45. Showed how two nearly contiguous point mutations in the same domain of the encoded Smoothened protein can produce striking phenotypic differences in cerebellar development and organization in mice. PMID: 22869526
  46. Observed that different pools of Smo move into cilia through distinct mechanisms. PMID: 22864913
  47. Found that Smo mRNA was expressed in the face of embryos at 11 and 12.5 days post coitum (dpc). After 13.5 dpc, the expression decreased to a low level and was faintly detected after birth. PMID: 21859383
  48. Concluded that inhibition of hedgehog signaling exerted potent antifibrotic effects in preclinical models of SSc in both preventive and therapeutic settings. PMID: 22402139
  49. Observed that inhibition of the Hh pathway can reduce tumor burden, regardless of tumor Hh responsiveness, through effects on tumor cells, OCs, and stromal cells within the tumor microenvironment. PMID: 22186138
  50. Found that Arl13b regulates the ciliary entry of Smo. PMID: 21976698

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is the role of Smoothened (Smo) in the Hedgehog signaling pathway?

Smoothened (Smo) functions as the central transducer of Hedgehog signaling across the cell membrane. It is essential for Hedgehog pathway activation, with the pathway remaining inactive in the absence of ligand due to inhibition by the Patched-1 (PTCH1) receptor. When Hedgehog ligands bind to PTCH1, this inhibition is relieved, allowing Smo to activate downstream signaling events. The Hedgehog signaling network regulates critical biological processes including pattern formation, proliferation, cell fate determination, and stem/progenitor cell self-renewal in multiple organ systems . Homozygous loss-of-function of Smo during development is embryonically lethal at E9.5, highlighting its essential role in developmental processes .

How is Smo genetically manipulated in mouse models for research purposes?

Researchers commonly utilize conditional knockout approaches to circumvent the embryonic lethality associated with complete Smo deletion. A frequently employed model is the homozygous SmoC/C mouse, in which exon 1 is flanked by loxP sites (floxed). These mice can be bred with tissue-specific or inducible Cre recombinase-expressing lines, such as Mx1-Cre, to enable targeted deletion in specific tissues or at desired timepoints . For inducible systems like Mx1-Cre, polyinosinic:polycytidylic acid (pIpC) injection induces interferon expression, triggering Cre activation and subsequent excision of the floxed Smo allele. Confirmation of excision is typically performed using semi-quantitative three-primer PCR analysis to verify complete deletion of wild-type Smo in the targeted tissues .

What genotyping strategies are recommended for Smo conditional knockout models?

For routine genotyping of Smo floxed alleles in mouse models, researchers should employ PCR on tail DNA using specific primers. The recommended protocol involves:

  • Using standard PCR master mix kits (e.g., Promega PCR Master Mix)

  • Preparing 13 μl total PCR volume, including 1 μl of 1:10 diluted tail DNA

  • Utilizing specific primers: Smo-1 forward (5′-GCAAGCTCGTGCTCTGGTC-3′) and Smo-2 reverse (5′-CCGGTGGATGTGGAATGTG-3′), which generate a 250 bp band

For Mx1-Cre genotyping, a separate PCR should be performed using: Cre reverse (5′-ACGACCGGCAAACGGACAGAAGCA-3′) and Mx1 forward (5′-CCCAACCTCAGTACCAAGCCAAG-3′) primers, with 25 μl total PCR volume including 1 μl of undiluted tail DNA .

How should researchers design experiments to investigate Smo function in angiogenesis?

When investigating Smo function in angiogenesis, researchers should consider both in vivo and ex vivo experimental approaches. The corneal neovascularization assay represents a robust in vivo method to assess Smo's role in angiogenesis. This approach involves:

  • Preparing Sonic Hedgehog (Shh) pellets by mixing 10 μg Shh protein with 5 mg sucrose octasulfate-aluminum complex, then adding 12% hydron in ethanol

  • Depositing the suspension on a 400 μM nylon mesh and coating both sides with hydron

  • Implanting the pellets in mouse corneas under anesthesia (125 mg/kg Avertin, intraperitoneal)

  • Using control pellets without Shh in the contralateral eye

  • Assessing angiogenesis 7 days post-implantation by injecting 50 μL fluorescein-BS1-Lectin I via tail vein

  • Harvesting and fixing eyes with 1% paraformaldehyde, then excising corneas for fluorescent microscopy

This model allows direct visualization and quantification of Shh-induced angiogenesis, while comparing endothelial Smo-null mice with wild-type counterparts provides insights into the requirement of endothelial Smo for this process.

What methodologies are appropriate for studying Smo function in hematopoietic stem cells?

To investigate Smo function in hematopoietic stem cells, researchers should employ a multi-faceted approach combining flow cytometry, functional colony assays, and in vivo bone marrow transplantation:

  • Flow cytometry analysis: Use multiparameter flow cytometry to quantify hematopoietic stem and progenitor cell populations, including Lin−Sca1+cKit+ (LSK) cells and myeloid progenitor subpopulations (common myeloid progenitors [CMPs], granulocyte-monocyte progenitors [GMPs], and megakaryocyte-erythroid progenitors [MEPs]) .

  • Colony-forming unit (CFU) assays: Plate bone marrow cells in methylcellulose medium (e.g., MethoCult3434) at 20,000 cells/ml. Score differential colony counts 7-10 days after plating to assess proliferation and differentiation potential .

  • Competitive bone marrow transplantation: Transplant Smo-null or wild-type donor bone marrow (CD45.2) in various ratios with competitor wild-type bone marrow (CD45.1/CD45.2) into irradiated recipients. This approach enables differentiation between donor, competitor, and recipient populations using flow cytometry with fluorochrome-labeled CD45.1/CD45.2 antibodies .

  • Serial transplantation: Perform secondary and tertiary transplants to assess long-term self-renewal capacity of hematopoietic stem cells in the absence of Smo.

How can researchers isolate primary cells with Smo deletion for in vitro studies?

For isolating primary cells with Smo deletion (such as cardiac endothelial cells), researchers should follow this methodological approach:

  • Harvest target organs (e.g., hearts) from Smo-null and control mice

  • Wash with ice-cold saline to remove blood

  • Mince tissue to approximately 1 mm pieces

  • Perform enzymatic digestion using appropriate tissue-specific protocols

  • For endothelial cell isolation, use CD31-based magnetic selection or fluorescence-activated cell sorting

  • Confirm Smo deletion efficiency using qPCR, Western blotting, or immunofluorescence

  • Culture isolated cells in appropriate growth media with supplements specific to the cell type

Researchers should verify the purity of isolated cell populations using lineage-specific markers and assess cell viability prior to downstream experiments.

How does Smo activation impact mammary gland development and potential cancer initiation?

Studies utilizing transgenic overexpression of activated human SMO (SmoM2) under the mouse mammary tumor virus (MMTV) promoter have revealed significant impacts on mammary epithelial biology. SmoM2 expression leads to:

  • Increased proliferation and altered differentiation of mammary epithelial cells

  • Development of ductal dysplasias distinct from those caused by Patched-1 (PTCH1) heterozygosity

  • Enhanced mammosphere-forming efficiency of primary mammary epithelial cells

  • Decreased frequency of regenerative stem cells in transplantation assays

These findings suggest that altered Hedgehog signaling via SMO activation contributes to breast cancer development through dual mechanisms: stimulating proliferation and increasing the pool of division-competent cells capable of anchorage-independent growth, rather than expanding the stem cell compartment per se. Notably, in both human tumors and MMTV-SmoM2 mice, SMO rarely colocalizes with the Ki67 proliferation marker, suggesting complex paracrine effects of Hedgehog signaling .

What are the implications of Smo deletion on leukemogenesis and hematologic malignancies?

Contrary to expectations, conditional deletion of Smo in the adult hematopoietic compartment does not significantly impact normal hematopoiesis or leukemogenesis driven by the MLL-AF9 oncogene. Experimental evidence demonstrates:

  • No differences in peripheral blood counts, spleen, thymus, or liver weights between Smo-null and wild-type mice up to 18 months after Smo deletion

  • Similar numbers of hematopoietic stem and progenitor cell populations (LSK cells and myeloid progenitors)

  • Comparable cell cycle profiles in LSK and myeloid progenitor cells

  • Equivalent serial replating potential of MLL-AF9-transduced bone marrow cells from Smo-null versus wild-type animals

  • No differences in disease penetrance, latency, or phenotype of MLL-AF9-driven acute myeloid leukemia between the two groups

How do paracrine versus autocrine Hedgehog signaling mechanisms influence Smo-dependent angiogenic responses?

Research has revealed that Smo-dependent Hedgehog signaling in endothelial cells may be less critical for angiogenesis than previously thought. Studies comparing endothelial-specific Smo knockout mice (eSmoNull) with wild-type counterparts (eSmoWT) demonstrated:

  • No observable phenotype in eSmoNull mice at baseline, with normal cardiac function

  • After hind-limb ischemia (HLI), no significant differences in perfusion ratio, limb motor function, or limb necrosis between eSmoNull and eSmoWT mice

  • Similar capillary densities in ischemic limbs of both mouse groups

Cell TypeDirect Shh TreatmentConditioned Media from Shh-treated Fibroblasts
Endothelial cellsLimited proliferation and migrationEnhanced proliferation and migration
FibroblastsUpregulated angiogenic factorsN/A

These data demonstrate that Shh signaling via Smo in endothelial cells is not required for angiogenesis and ischemic tissue repair. Instead, Shh likely mediates its angiogenic effects primarily through stromal cells in a paracrine fashion .

What controls are essential when studying phenotypes in Smo conditional knockout models?

When designing experiments with Smo conditional knockout models, researchers must implement rigorous controls to ensure proper interpretation of results:

  • Genotype confirmation: Always verify complete excision of the Smo allele using three-primer PCR techniques that can distinguish between floxed and excised alleles.

  • Cre-only controls: Include Cre+ mice without floxed alleles to account for potential Cre toxicity or leakiness.

  • Temporal controls: For inducible systems like Mx1-Cre, analyze mice at multiple timepoints after induction (e.g., 4 weeks, 12 weeks, 6 months, and 18 months) to distinguish between acute and chronic effects of Smo deletion .

  • Cell-specific validation: For tissue-specific deletion, isolate the targeted cell population (e.g., CD31+ endothelial cells) and confirm Smo reduction at both mRNA and protein levels .

  • Functional validation: Verify pathway inhibition by assessing expression of Hedgehog target genes or using pathway reporter assays.

  • Compensatory mechanisms: Consider potential upregulation of alternative pathway components, especially in long-term knockout studies.

How should researchers interpret conflicting data regarding Smo's role in specific biological processes?

When encountering conflicting data regarding Smo's role in biological processes, researchers should consider several factors:

  • Model systems: Different model systems (in vitro cell culture, ex vivo organ culture, in vivo animal models) may yield different results due to varying complexity and presence of non-cell-autonomous effects.

  • Genetic background: The genetic background of mouse models can significantly influence phenotypes. For example, C57/Bl6 mice may show different responses compared to other strains.

  • Developmental stage: The role of Smo may vary during development versus adult homeostasis. Embryonic deletion often leads to lethality, while adult deletion may have minimal phenotypes in some tissues .

  • Cell type specificity: Smo function may differ between cell types. For instance, endothelial Smo appears dispensable for angiogenesis, while stromal Smo mediates important paracrine effects .

  • Compensatory mechanisms: Long-term genetic deletion may allow for compensatory pathways to develop, masking the acute effects of Smo loss.

  • Technical factors: Differences in knockout efficiency, experimental conditions, and analysis methods may contribute to conflicting results.

Researchers should design experiments that specifically address these variables and consider using multiple complementary approaches (genetic models, pharmacological inhibition, and gain-of-function studies) to comprehensively evaluate Smo's role.

What methodological considerations are important when utilizing pharmacological modulators of Smo in research?

When incorporating pharmacological modulators of Smo in research, several methodological considerations are crucial:

  • Specificity verification: Confirm the specificity of Smo modulators through parallel genetic approaches or by using multiple compounds with different chemical structures but similar mechanisms.

  • Dose-response relationships: Establish complete dose-response curves to determine optimal concentrations for pathway inhibition or activation without off-target effects.

  • Vehicle controls: Always include appropriate vehicle controls as solvents (DMSO, ethanol) may have biological effects at higher concentrations.

  • Pharmacokinetics and tissue distribution: For in vivo studies, determine the compound's pharmacokinetics, bioavailability, and tissue distribution to ensure target engagement.

  • Pathway activity confirmation: Validate that the modulator affects Hedgehog pathway activity using established readouts such as Gli1 or Ptch1 expression.

  • Experimental implementation: For in vitro studies with Smo modulators (e.g., rSHH at 100 ng/ml or HhAntag at 300 nM) in hematopoietic colony assays, add compounds directly to methylcellulose medium before plating cells, and score colonies 7-8 days after plating .

  • Combined approaches: Consider using pharmacological modulators in combination with genetic models (e.g., treating Smo-null cells with pathway antagonists) to distinguish on-target from off-target effects.

What emerging technologies might advance our understanding of Smo in development and disease?

Several cutting-edge technologies hold promise for deepening our understanding of Smo biology:

  • Single-cell transcriptomics and proteomics: These approaches can reveal cell-specific responses to Hedgehog pathway modulation and identify previously unrecognized Smo-dependent cellular states.

  • CRISPR-Cas9 gene editing: Beyond traditional knockout approaches, CRISPR technologies enable precise editing of specific Smo domains or regulatory elements to dissect structure-function relationships.

  • Organoid cultures: Three-dimensional organoid systems derived from primary tissues or pluripotent stem cells provide physiologically relevant models for studying Smo function in tissue morphogenesis and homeostasis.

  • Intravital imaging: Real-time visualization of Hedgehog signaling in live animals using reporter systems can provide insights into the dynamics of pathway activation in development and disease.

  • Spatial transcriptomics: These methods can map Hedgehog pathway activity within tissues with spatial resolution, revealing how Smo-mediated signaling creates morphogen gradients and influences neighboring cells.

  • Proteomics and interactomics: Comprehensive analysis of Smo-interacting proteins and post-translational modifications can identify novel regulators and mechanisms of Smo function.

What are the unresolved questions regarding cross-talk between Smo and other signaling pathways?

Several critical questions remain regarding Smo's interactions with other signaling networks:

  • Wnt pathway interactions: How does Smo-mediated Hedgehog signaling coordinate with Wnt/β-catenin pathway in stem cell maintenance and cancer development?

  • Notch signaling: What mechanisms underlie the reported synergism between Hedgehog and Notch pathways in development and disease contexts?

  • Growth factor signaling: How does Smo activation influence or respond to growth factor pathways like PDGF, which appears to be significantly upregulated by Hedgehog signaling in fibroblasts ?

  • Inflammatory signaling: What is the relationship between Hedgehog pathway activation and inflammatory responses in chronic diseases and cancer?

  • Metabolic regulation: How does Smo activity influence or respond to cellular metabolic state, and what role might this play in diseases with metabolic components?

  • Upstream regulators: Beyond canonical Hedgehog ligands, what other factors can modulate Smo activity in physiological and pathological conditions?

Addressing these questions will require integrated experimental approaches combining genetic models, biochemical analyses, and systems biology to map the complex network of interactions centered on Smo.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.