Recombinant Mouse Hepatic sodium/bile acid cotransporter (Slc10a1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant mouse hepatic sodium/bile acid cotransporter (Slc10a1), also known as sodium-taurocholate cotransporting polypeptide (Ntcp), is a key membrane protein involved in sodium-dependent uptake of bile acids in hepatocytes. It belongs to the solute carrier family 10 (SLC10A) and is critical for maintaining bile acid homeostasis and cholesterol metabolism . Recombinant versions of this protein are widely used to study bile acid transport mechanisms, liver physiology, and drug interactions.

Gene and Protein Overview

  • Gene Name: Slc10a1 (solute carrier family 10 member 1) .

  • Protein: Sodium/bile acid cotransporter with a molecular weight of ~39.4 kDa (mouse) .

  • Domains: Contains 7–9 transmembrane helices, critical for bile acid binding and sodium coupling .

Recombinant Production Systems

Recombinant Slc10a1 is expressed in heterologous systems for functional studies:

Expression SystemTagPurityApplicationsSource
HEK293T cellsMyc/DDK>80%Transport assays, binding studies
YeastNone>50 μg/mLStructural studies
E. coliAviTag (biotinylated)N/AProtein interaction assays

Transport Activity

  • Substrates: Bile acids (e.g., taurocholate), non-bile acid organic anions, and drugs like rosuvastatin .

  • Sodium Dependence: Strictly requires extracellular Na⁺ for activity .

  • Kinetics: Exhibits high affinity for taurocholate (Kₘ = ~25 μM in rodents) .

Knockout Mouse Phenotypes

  • Hypercholanemia: Slc10a1⁻/⁻ mice show elevated serum bile acids (up to millimolar levels) .

  • Compensatory Mechanisms: Organic anion-transporting polypeptides (OATPs) partially offset bile acid uptake deficits .

Drug Development

  • Drug Transport Screening: Used to assess hepatic uptake of statins, antivirals, and cytotoxic drugs .

  • HBV Entry Studies: Slc10a1 mediates hepatitis B virus (HBV) preS1 domain binding, facilitating viral entry .

Antibody Production

  • Anti-Slc10a1 Antibodies: Commercial antibodies (e.g., PA1670, bs-1958R) validated for WB, IHC, and ELISA .

    • Epitopes: Target mid-region (aa 21–120) or C-terminal domains .

Mutations and Disease Associations

MutationEffectClinical PhenotypeReference
c.800C>T (p.Ser267Phe)Loss of transport functionHypercholanemia, growth retardation
c.595A>C (p.Ser199Arg)Disrupted membrane localizationAsymptomatic hypercholanemia

Therapeutic Targeting

  • Cholestasis: NTCP inhibitors (e.g., myrcludex B) are explored for HBV therapy .

  • Drug Delivery: Conjugation of drugs with bile acids enhances hepatocyte-specific uptake via Slc10a1 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc10a1; Ntcp; Sodium/bile acid cotransporter; Na(+/bile acid cotransporter; Na(+/taurocholate transport protein; Sodium/taurocholate cotransporting polypeptide; Solute carrier family 10 member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MEAHNVSAPFNFSLPPGFGHRATDTALSVILVVMLLLIMLSLGCTMEFSKIKAHFWKPKG VIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSI VMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKR PHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTPHLLATSSLMPFTGFLMGYIL SALFRLNPSCRRTISMETGFQNVQLCSTILNVTFPPEVIGPLFFFPLLYMIFQLAEGLLF IIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEKGTHNGNNPPTQPGLSPNGLNSGQM AN
Uniprot No.

Target Background

Function
The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. Its function is strictly dependent on the presence of extracellular sodium.
Gene References Into Functions
  1. NTCP and OATP isoforms collaborate to form a stable bile acid uptake machinery in mice, while NTCP is the predominant transporter in humans. PMID: 28498614
  2. Isoniazid/rifampicin administration significantly down-regulates the expression of hepatic bile acids transporters Ntcp and Bsep in the liver. PMID: 25886055
  3. Ntcp plasma membrane localization is regulated by hyperosmolarity and tauroursodeoxycholate. PMID: 26306036
  4. NTCP plays a central role in hepatic uptake of conjugated bile acids and hepatitis B virus preS1/Myrcludex B binding. PMID: 25641256
  5. mNTCP was found to be unable to support either HBV or HDV infection, despite its ability to bind to pre-S1 of HBV L protein and transport the substrate taurocholate. PMID: 23678176
  6. Hepatic transporters Ntcp and Mrp2 are downregulated in rodent models of necrotizing enterocolitis. PMID: 23125159
  7. Significant variations in hepatic bile salt flux have minimal effects on the expression of murine Ntcp and Bsep in vivo, suggesting that these transporters are abundantly expressed and can accommodate a wide range of 'physiological' bile salt fluxes. PMID: 12399219
  8. Conserved NTCP/Ntcp 5'-regulatory region transcription regulation differs among species and is not directly regulated by small heterodimer partner. Bile acids may regulate NTCP/Ntcp indirectly by modulating nuclear factor regulation of gene expression. PMID: 14701722
  9. Reduced levels of HNF-1alpha, RXRalpha, and RARalpha in CBDL FXR-/- mice and reduced DNA binding in CA-fed FXR-/- mice, despite unchanged Ntcp levels, indicate that these factors may play a minor role in regulating mouse Ntcp during cholestasis. PMID: 16002565
  10. The C51A and C106A mutants of Slc10a2 showed significantly reduced TCA uptake, while no apparent difference in TCA uptake was observed for the Slc10a1-C44A mutant. PMID: 17690477
  11. Ntcp and Bsep are regulated by age, gender, cholestyramine, and bile acid, but resistant to induction by most microsomal enzyme inducers. PMID: 17897632
  12. Mouse Ntcp is regulated by HNF-4alpha via a conserved distal cis-element independently of HNF-1alpha. PMID: 18483185
  13. This study highlights the critical role of PPAR-alpha in perfluorooctanoic acid- and perfluorodecanoic acid-induced downregulation of Ntcp uptake transporter in mouse liver. PMID: 18703564
  14. In the liver, histone H3 in the proximal promoter of Ntcp is hyperacetylated, whereas acetylation in the kidney and cerebrum is minimal. PMID: 19047482
  15. This report emphasizes the role of hepatic Ntcp transporter in preventing bile acid toxicity after partial hepatectomy in mice. PMID: 19497955

Show More

Hide All

Database Links
Protein Families
Bile acid:sodium symporter (BASS) (TC 2.A.28) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of mouse Slc10a1 and how does it compare to human SLC10A1?

Mouse Slc10a1, like its human counterpart, is predicted to contain multiple transmembrane domains that form panel and core structures essential for its function. While specific mouse Slc10a1 structural data is limited, related sodium-bile acid co-transporters typically contain approximately ten transmembrane domains with bile acid-binding sites and multiple sodium-binding sites that coordinate symport processes . The tertiary structure includes both inward-facing and outward-facing conformations that facilitate substrate translocation across cell membranes.

For structural analysis of mouse Slc10a1, researchers should consider:

  • Homology modeling based on crystallized bacterial ASBT structures from organisms like Neisseria meningitidis and Yersinia frederiksenii

  • Identification of conserved transmembrane domains, particularly TM3, TM4, TM6, and TM7 for bile acid interactions, and TM2 and TM5 for sodium ion translocation

  • Comparison with human SLC10A1 to identify species-specific structural differences that may affect substrate specificity or transport kinetics

How is mouse Slc10a1 expressed and regulated in the liver compared to other tissues?

Mouse Slc10a1 demonstrates tissue-specific expression patterns primarily localized to the liver. In hepatocytes, Slc10a1 is predominantly expressed in basolateral membranes where it functions to uptake bile acids from the circulation . Unlike some other bile acid transporters that show broader tissue distribution, Slc10a1 expression is largely liver-specific, making it an excellent target for liver-focused research.

For studying Slc10a1 expression:

  • Immunohistochemistry with specific anti-Slc10a1 antibodies can reveal cellular and subcellular localization

  • qRT-PCR analysis comparing expression levels across different tissues

  • Western blot analysis for protein quantification, with recombinant Slc10a1 serving as a positive control

  • Reporter gene assays to investigate transcriptional regulation of the Slc10a1 promoter

  • Analysis of nuclear receptor binding sites (particularly FXR) in the promoter region to understand metabolic regulation

What are the fundamental differences between mouse and human bile acid metabolism relevant to Slc10a1 research?

The most significant difference between mouse and human bile acid metabolism is the abundant synthesis of 6-hydroxylated bile acids in mice, which constitute half or more of the mouse bile acid pool . These 6-hydroxylated bile acids, particularly β-muricholate (βMCA), have different physicochemical properties compared to human bile acids—they are more water-soluble, relatively poor detergents, and have altered signaling properties .

Research considerations should include:

  • Awareness that mouse 6-hydroxylated bile acids are poor activators or even antagonists of FXR, unlike the primary human bile acids

  • Recognition that pathways affecting 6-hydroxylated bile acid composition in mice have profound metabolic effects that may not directly translate to humans

  • Understanding that UDCA appears to be a biosynthetic precursor to βMCA in mice through a pathway involving hepatic 7α-hydroxysteroid dehydrogenase oxidation of CDCA to 7-oxolithocholic acid

  • Use of targeted bile acid profiling to characterize species-specific bile acid composition when interpreting transporter function

How can researchers effectively design expression systems for producing functional recombinant mouse Slc10a1?

Producing functional recombinant mouse Slc10a1 requires careful consideration of expression systems and protein purification strategies. Based on approaches used for related transporters, researchers should consider:

  • Bacterial expression systems (E. coli): While simpler, these may struggle with proper folding of complex membrane proteins. If using E. coli, consider fusion tags that enhance solubility and specialized strains for membrane protein expression .

  • Mammalian expression systems: These provide better post-translational modifications and membrane integration but at lower yields. HEK293 or CHO cells are preferred for functional studies.

  • Insect cell systems: Offer a balance between proper folding and reasonable yields for membrane proteins.

For protein purification:

  • Utilize affinity tags (His-tag, as demonstrated with human SLC10A1)

  • Employ detergent screening to identify optimal solubilization conditions that maintain function

  • Consider nanodiscs or liposome reconstitution for functional studies

  • Verify protein integrity through SDS-PAGE, Western blotting, and transport assays

For quality control, researchers should assess:

  • Protein purity (>95% is achievable, as seen with human SLC10A1)

  • Endotoxin levels (<1.0 EU per 1μg using LAL method)

  • Thermal stability (assess by accelerated thermal degradation test at 37°C)

  • Functional activity through transport assays with radiolabeled or fluorescent bile acid substrates

What are the critical considerations when designing bile acid transport assays for recombinant mouse Slc10a1?

Designing robust transport assays for mouse Slc10a1 requires careful attention to experimental conditions that maintain physiological relevance:

Transport Assay Methodology Table:

ParameterRecommended ConditionRationale
Expression SystemTransfected cell lines (HEK293, CHO) or Xenopus oocytesProvides native membrane environment
Substrate SelectionTaurocholate, glycocholate, and murine-specific bile acids (βMCA)Accounts for species differences in substrate preference
Sodium Concentration137-145 mMPhysiological sodium levels required for co-transport
pH7.2-7.4Optimal for Slc10a1 function
Temperature37°CPhysiological temperature for mammalian transporters
Time Points0.5, 1, 2, 5, 10 minutesCaptures initial rate and equilibrium
Inhibitor ControlsPolyacrylic acid–tetradeoxycholic acid conjugateKnown SBAT inhibitor

Critical considerations include:

  • Using sodium-free buffers as negative controls to confirm sodium-dependent transport

  • Including species-specific bile acid substrates, particularly 6-hydroxylated bile acids like βMCA

  • Employing multiple detection methods (radiolabeled substrates, fluorescent bile acid derivatives, LC-MS/MS)

  • Analyzing kinetic parameters (Km, Vmax) to characterize transporter function

  • Comparing wild-type and mutant transporters to assess functional consequences of specific residues

How can mouse models with Slc10a1 mutations advance our understanding of bile acid-related disorders?

Mouse models with Slc10a1 mutations provide valuable insights into bile acid transport and metabolism in health and disease states. These models can be developed and utilized through several approaches:

  • CRISPR/Cas9-mediated generation of knockout or knockin mice carrying specific mutations identified in human SLC10A1-related disorders

  • Characterization of bile acid pool composition, with particular attention to shifts in 6-hydroxylated bile acids and FXR signaling

  • Analysis of compensatory mechanisms (upregulation of alternative transporters) that may mask phenotypes

  • Comparison with human clinical presentations to identify species-specific differences

When investigating these models, researchers should:

  • Perform comprehensive bile acid profiling using LC-MS/MS to characterize changes in bile acid composition

  • Assess liver function through biochemical markers (ALT, AST, bilirubin, GGT)

  • Examine enterohepatic circulation using bile duct cannulation and radiotracer studies

  • Combine with dietary challenges (high-fat diet, bile acid supplementation) to reveal phenotypes that may not be apparent under normal conditions

Notable findings from related studies include elevated serum DBIL, ALT, AST, and GGT levels in human NTCP deficiency patients compared to healthy controls , which could guide biomarker selection in mouse models.

What troubleshooting approaches should be employed when recombinant mouse Slc10a1 shows poor expression or activity?

When facing challenges with recombinant mouse Slc10a1 expression or activity, consider these systematic troubleshooting approaches:

Expression Optimization:

  • Codon optimization for the expression system being used

  • Testing multiple affinity tags and their positions (N-terminal vs. C-terminal)

  • Using specialized vectors with strong promoters designed for membrane proteins

  • Evaluating different cell types and growth conditions (temperature, induction time)

  • Adding chemical chaperones to improve folding (glycerol, DMSO at low concentrations)

Purification Optimization:

  • Screening various detergents (DDM, CHAPS, LDAO) for optimal solubilization

  • Utilizing stabilizing additives in buffers (cholesterol, specific lipids)

  • Implementing size exclusion chromatography to isolate properly folded protein

  • Considering nanodiscs or liposome reconstitution for functional recovery

Activity Troubleshooting:

  • Verifying sodium dependency by testing transport in sodium-free conditions

  • Examining pH dependence (pH 6.5-8.0) to identify optimal transport conditions

  • Testing multiple bile acid substrates, including mouse-specific compounds

  • Evaluating potential inhibitory compounds in the experimental system

  • Assessing protein orientation in reconstituted systems

For long-term storage and stability:

  • Determine optimal storage conditions (avoid repeated freeze/thaw cycles)

  • Use stabilizing agents like trehalose (5%) in storage buffers

  • Consider flash-freezing aliquots for long-term storage at -80°C

How should researchers interpret conflicting data from mouse Slc10a1 studies in the context of species differences?

When confronting contradictory findings between mouse and human studies involving Slc10a1/SLC10A1, researchers should systematically evaluate:

  • Bile acid pool composition differences: The predominance of 6-hydroxylated bile acids in mice significantly alters signaling properties and interactions with nuclear receptors like FXR

  • Regulatory pathway divergence: Pathways affecting bile acid composition have profound species-specific metabolic effects

  • Compensatory mechanisms: Alternative transporters may be upregulated differently between species

  • Experimental design variations: Differences in methodologies, diets, or environmental factors may contribute to inconsistent results

Resolution strategies include:

  • Conducting parallel experiments in both mouse and human systems

  • Using humanized mouse models expressing human SLC10A1

  • Performing comprehensive bile acid profiling to account for species differences

  • Supplementing in vivo studies with in vitro transport assays using recombinant proteins

  • Considering evolutionary perspectives and selective pressures that may have shaped species differences

It's worth noting that while genetic variations in human SLC10A1 have been investigated for associations with persistent HBV infection, comprehensive assessments have found little evidence of such associations , highlighting the importance of rigorous validation of findings from mouse models.

What controls and validation methods are essential when studying the interaction between mouse Slc10a1 and potential drug compounds?

When investigating interactions between mouse Slc10a1 and drug compounds, robust controls and validation methods are critical:

Essential Controls:

  • Positive controls: Known Slc10a1 substrates (taurocholate, glycocholate)

  • Negative controls: Sodium-free conditions to eliminate transport activity

  • Specificity controls: Related transporters (Oatp family) to confirm target specificity

  • Vehicle controls: Matched solvent conditions for compound testing

  • Expression controls: Non-transfected cells or cells expressing unrelated transporters

Validation Methods:

  • Concentration-response relationships: Test compounds at multiple concentrations (at least 5-6 concentrations spanning 3 log units)

  • Multiple methodologies: Combine direct transport assays with binding studies and cellular uptake

  • Bidirectional transport: Assess both uptake and efflux if applicable

  • Kinetic analysis: Determine if inhibition is competitive, non-competitive, or uncompetitive

  • In vivo confirmation: Validate findings using targeted knockout models

For data analysis and interpretation:

  • Calculate and report standard parameters (IC50, Ki values)

  • Consider species differences when extrapolating to human applications

  • Assess potential off-target effects on related transporters

  • Evaluate the physiological relevance of observed interactions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.