Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4 (Nkain4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol uses 50% glycerol; this can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Nkain4; Fam77a; Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 4; Na(+/K(+-transporting ATPase subunit beta-1-interacting protein 4; Protein FAM77A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Nkain4
Target Protein Sequence
MGFCSGRCTLLALCALQLVTALERQVFDFLGYQWAPILANFTHIIVVILGLFGTIQYRPR YIVVYVVWAAVWVTWNVFIICFYLEVGGLSKDSELLTFNLSGHRSWWEEHGPGCLHEEEA TAGLGALHGQSLVVGAGCAMVHSYVEALHSGLQILLALLGFVYGCYVVSVLTEEEDSFDF IGGFDPFPLYHVNEKPSSLLSKQAYLPA
Uniprot No.

Target Background

Database Links
Protein Families
NKAIN family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitous. Expressed in multiple regions of the brain such as cerebral cortex, thalamus, hippocampus, olfactory bulb and brainstem as well as in cerebellum with low expression in granular cell layer.

Q&A

What is Nkain4 and what is its primary function?

Nkain4 is a protein named for its interaction with the β1 subunit of Na⁺/K⁺ transporting ATPase (sodium-potassium pump). This transmembrane protein plays a critical role in modulating sodium-potassium pump activity, which is essential for maintaining cellular electrochemical gradients and osmotic pressure . Beyond its role in ion transport regulation, emerging evidence suggests Nkain4 may function in signal transduction pathways involved in cell growth, differentiation, and survival mechanisms . Research indicates its involvement in cancer progression, particularly in colorectal adenocarcinoma, and in regulating immune cell activities.

How does Nkain4 interact with the sodium-potassium pump?

Nkain4 primarily interacts with the β1 subunit of the Na⁺/K⁺-ATPase complex. This interaction appears to modulate the activity of the sodium-potassium pump, which functions by removing 3 Na⁺ ions from the cell while importing 2 K⁺ ions through ATP hydrolysis . The exact molecular mechanisms by which Nkain4 regulates this pump remain under investigation, but current data suggests Nkain4 may enhance pump activity by activating β1 subunit expression. This modulation affects fundamental cellular processes since the sodium-potassium pump not only maintains ion gradients but also acts as a scaffold for protein interactions and as a signal transduction molecule .

What expression patterns of Nkain4 have been observed in mouse tissues?

Nkain4 demonstrates variable expression across different mouse tissues. In the comprehensive mouse brain cell-type atlas, Nkain4 has been identified within specific cell populations, though not as prominently featured as certain transcription factor families that show region-specific expression patterns . Current transcriptomic analyses have detected Nkain4 in various tissues, with notable expression in immune cells and certain neuronal populations. When studying Nkain4 expression, researchers should consider using sensitive detection methods such as RNAscope in situ hybridization or qPCR for accurate tissue localization and quantification.

What role does Nkain4 play in cancer progression?

Recent studies have implicated Nkain4 in cancer progression, particularly in colon adenocarcinoma (COAD). Differential expression analysis between primary tumors with and without lymph node metastasis (LNM) has identified Nkain4 as one of five genes significantly associated with LNM in COAD . The mechanism appears to involve Nkain4's promotion of sodium-potassium pump activity, potentially enhancing tumor cell proliferation and migration capabilities. Furthermore, genomic investigations have revealed that Nkain4 alterations show statistically significant co-occurrence with several immune checkpoints, including OBSCN, MUC16, and MUC17 . This suggests Nkain4 may function as a coregulator of immune checkpoints in COAD, potentially contributing to the tumor immune microenvironment that facilitates metastasis.

How does Nkain4 relate to immune cell function?

Nkain4 demonstrates a significant correlation with T follicular helper (Tfh) cells in colon adenocarcinoma tissues, although this correlation is modest (R=0.23, P<0.05) . This relationship suggests Nkain4 may play a role in regulating the tumor immune microenvironment. Elevated Tfh cell infiltration has been observed in COAD tissues with lymph node metastasis, and Nkain4 expression correlates with this increased infiltration. Researchers speculate that Nkain4 may contribute to higher levels of immune tolerance in metastatic tissues, potentially through its interaction with immune checkpoints . Additionally, a related transcript known as Natural Killer Cell Transcript 4 (NK4) has been shown to promote autoimmune disorders through its effects on B cells, with elevated levels observed in Sjögren's Syndrome patients . While the exact relationship between Nkain4 and NK4 requires further elucidation, these findings highlight the importance of immune-related functions for this protein family.

What is known about Nkain4's potential role in neurological function?

While comprehensive brain cell-type atlases have been developed for mice, specific information about Nkain4's role in neurological function remains limited. The Allen Brain Cell Atlas, which comprises approximately 4.0 million high-quality single-cell transcriptomes and spatial transcriptomic data from approximately 4.3 million cells, provides a foundation for investigating cell type-specific expression patterns . Within this resource, researchers can examine Nkain4 expression across 34 classes, 338 subclasses, 1,201 supertypes, and 5,322 clusters of brain cells to gain insights into its potential neurological functions. Given Nkain4's interaction with the sodium-potassium pump, which is crucial for neuronal excitability and signaling, further investigation into its role in specific neuronal populations is warranted. When designing experiments to explore Nkain4's neurological functions, researchers should consider leveraging single-cell RNA sequencing data and spatial transcriptomics to identify specific cell populations with notable Nkain4 expression.

What techniques are recommended for studying Nkain4 expression?

For comprehensive analysis of Nkain4 expression, multiple complementary techniques are recommended:

  • Single-cell RNA sequencing (scRNA-seq): This approach allows for high-resolution profiling of Nkain4 expression across heterogeneous cell populations. Following the methodologies used in the Allen Brain Cell Atlas, researchers can employ platforms such as 10x Genomics Chromium v2 or v3 for transcriptome analysis . Quality control should include filtering for gene counts and unique molecular identifier (UMI) counts, with subsequent clustering analysis to identify cell populations expressing Nkain4.

  • Spatial transcriptomics: Methods such as multiplexed error-robust fluorescence in situ hybridization (MERFISH) can provide spatial context to Nkain4 expression patterns within tissues . This enables correlation of expression with anatomical regions and neighboring cell types.

  • Quantitative PCR: For targeted validation, qPCR remains valuable for quantifying Nkain4 transcript levels across different samples or experimental conditions. This method should incorporate appropriate housekeeping genes for normalization.

  • Western blotting: Protein-level confirmation using specific antibodies against Nkain4, with verification of specificity using appropriate negative controls such as Nkain4 knockout samples.

  • Immunohistochemistry/Immunofluorescence: For spatial protein localization within tissues, these methods provide cellular and subcellular resolution of Nkain4 expression.

How can researchers produce recombinant mouse Nkain4 for experimental studies?

Production of high-quality recombinant mouse Nkain4 requires careful consideration of expression systems and purification strategies:

  • Expression vector selection: Clone the full-length mouse Nkain4 coding sequence into an appropriate expression vector, including tags (His, FLAG, or GST) to facilitate purification while considering their potential impact on protein function.

  • Expression system optimization:

    • Bacterial systems: While economical, these may be challenging for transmembrane proteins like Nkain4. If attempted, use specialized E. coli strains designed for membrane proteins.

    • Mammalian expression systems: HEK293 or CHO cells often provide proper folding and post-translational modifications. Transient transfection with optimized protocols or stable cell line generation offer flexibility depending on required yield.

    • Insect cell systems: Baculovirus expression in Sf9 or Hi5 cells represents an excellent compromise between yield and proper protein processing.

  • Purification strategy:

    • Consider detergent solubilization optimization for this transmembrane protein

    • Employ affinity chromatography based on the chosen tag

    • Include size exclusion chromatography as a polishing step

    • Verify protein integrity by SDS-PAGE, Western blot, and mass spectrometry

  • Functional validation: Confirm the activity of recombinant Nkain4 through its ability to interact with the Na⁺/K⁺-ATPase β1 subunit using co-immunoprecipitation or surface plasmon resonance.

What cell models are most suitable for investigating Nkain4 function?

Selection of appropriate cell models depends on the specific aspects of Nkain4 function under investigation:

  • Colorectal cancer cell lines: Given Nkain4's association with colon adenocarcinoma progression, cell lines such as HT29, HCT116, or SW480 provide relevant models for studying its role in cancer biology . These can be particularly useful for investigating:

    • Effects on proliferation, migration, and invasion

    • Interaction with immune checkpoints

    • Modulation of sodium-potassium pump activity in cancer contexts

  • Immune cell models: To study Nkain4's relationship with immune functions:

    • Primary mouse B cells for investigating potential roles similar to NK4 in autoimmunity

    • T follicular helper cell cultures to examine the correlation observed in clinical samples

    • Co-culture systems with cancer cells to model tumor-immune interactions

  • Neuronal models: Based on potential expression in brain tissues:

    • Primary mouse neuronal cultures

    • Brain organoids for three-dimensional context

    • Specific neuronal cell lines expressing sodium-potassium pumps

  • Genetically modified models: Consider generating:

    • CRISPR/Cas9 Nkain4 knockout cell lines

    • Cells with fluorescently tagged Nkain4 for localization studies

    • Inducible expression systems for temporal control of Nkain4 levels

How can transcriptomic analysis be used to study Nkain4 in different cell populations?

Advanced transcriptomic approaches offer powerful means to investigate Nkain4 expression patterns and regulatory networks:

  • Single-cell transcriptomics methodology:

    • Follow protocols similar to those used in the Allen Brain Cell Atlas, which generated approximately 7 million single-cell transcriptomes (with 4.0 million passing quality control)

    • Implement stringent quality control metrics to filter low-quality transcriptomes, assessing parameters such as gene counts, unique molecular identifier (UMI) counts, and potential doublets

    • Apply iterative clustering analysis using software such as the scrattch.bigcat package for cell type identification

    • Integrate data from different platforms (e.g., 10xv2, 10xv3) using appropriate batch correction methods

  • Cell type-specific expression analysis:

    • Map Nkain4 expression across hierarchically organized cell taxonomy (classes, subclasses, supertypes, and clusters)

    • Compute Pearson correlations of gene expression between clusters using differentially expressed genes as measures of similarity

    • Identify co-expression modules containing Nkain4 to reveal functional associations

  • Spatial context integration:

    • Combine scRNA-seq with spatial transcriptomics data using hierarchical mapping approaches

    • Assign cluster identities to spatially resolved cells based on correlation scores

    • Annotate Nkain4-expressing cell types with their anatomical locations

  • Differential expression analysis:

    • Compare Nkain4 expression in normal versus disease states

    • Identify conditions that modulate Nkain4 expression levels

    • Correlate expression with clinical parameters such as lymph node metastasis status

What methodological approaches can reveal Nkain4's role in immune regulation?

To investigate Nkain4's potential functions in immune regulation, researchers should consider these methodological approaches:

  • Immune cell infiltration analysis:

    • Implement computational deconvolution methods such as CIBERSORT to assess immune cell composition in tissues with varying Nkain4 expression levels

    • Specifically examine T follicular helper cell proportions, which have shown correlation with Nkain4 expression in colorectal cancer contexts

    • Generate correlation matrices between Nkain4 expression and various immune cell populations

  • Co-expression analysis with immune regulators:

    • Examine correlations between Nkain4 and immune checkpoint molecules

    • Investigate co-occurrence patterns in genomic alterations between Nkain4 and immune regulators (similar to findings with OBSCN, MUC16, and MUC17)

    • Perform pathway enrichment analysis to identify immune-related processes associated with Nkain4

  • Functional immune assays:

    • Measure T follicular helper cell differentiation and function in the presence of Nkain4 modulation

    • Assess B cell activation and antibody production in systems with altered Nkain4 expression, considering findings related to NK4 in autoimmune disorders

    • Evaluate cytokine production profiles in immune cells following Nkain4 manipulation

  • Animal models:

    • Develop conditional Nkain4 knockout mice targeting specific immune cell populations

    • Challenge with appropriate disease models (cancer, autoimmunity) to assess in vivo relevance

    • Analyze immune cell distribution and function in lymphoid organs

How should researchers investigate Nkain4's interactions with the sodium-potassium pump?

The interaction between Nkain4 and the sodium-potassium pump represents a fundamental aspect of its function and requires methodologically robust approaches:

  • Protein interaction confirmation:

    • Co-immunoprecipitation assays to verify direct interaction between Nkain4 and the β1 subunit of Na⁺/K⁺-ATPase

    • Proximity ligation assays to visualize interactions in situ within cells

    • FRET or BRET approaches to examine real-time dynamics of these interactions

  • Functional impact assessment:

    • Measure Na⁺/K⁺-ATPase activity using enzyme assays in systems with modulated Nkain4 levels

    • Monitor intracellular Na⁺ and K⁺ concentrations using fluorescent indicators in response to Nkain4 manipulation

    • Assess membrane potential changes using voltage-sensitive dyes or electrophysiological techniques

  • Mechanistic investigations:

    • Analyze β1 subunit expression and trafficking in response to Nkain4 modulation

    • Determine whether Nkain4 affects the stoichiometry or assembly of Na⁺/K⁺-ATPase complex components

    • Examine post-translational modifications of pump components in the presence/absence of Nkain4

  • Structural biology approaches:

    • Generate structural models of the Nkain4-Na⁺/K⁺-ATPase complex through X-ray crystallography or cryo-EM

    • Identify critical interaction domains through mutagenesis studies

    • Use molecular dynamics simulations to predict functional consequences of interactions

How can researchers address specificity issues in Nkain4 antibody-based experiments?

Ensuring antibody specificity is crucial for reliable Nkain4 research:

  • Validation controls:

    • Use Nkain4 knockout cell lines or tissues as negative controls

    • Compare multiple commercial antibodies targeting different epitopes

    • Perform peptide competition assays to confirm specific binding

    • Validate antibody specificity with recombinant Nkain4 protein

  • Complementary approaches:

    • Combine antibody-based detection with mRNA analysis (qPCR, in situ hybridization)

    • Consider epitope-tagged Nkain4 expression when feasible

    • Use orthogonal methods such as mass spectrometry to confirm protein identification

  • Technical optimization:

    • Carefully titrate antibody concentrations to minimize background

    • Optimize fixation and permeabilization conditions for immunostaining

    • Test different blocking reagents to reduce non-specific binding

    • Consider native versus denaturing conditions for Western blotting

How should conflicting data about Nkain4 function be interpreted?

When encountering contradictory findings regarding Nkain4 function:

  • Contextual factors to consider:

    • Cell type-specific effects: Nkain4 may function differently across cell types, particularly given its diverse potential roles in cancer and immune cells

    • Species differences: Consider whether conflicting data stems from studies in different species

    • Disease state variations: Function may differ between normal physiology and pathological conditions

    • Expression level effects: Overexpression versus physiological levels may yield different results

  • Methodological reconciliation:

    • Examine differences in experimental approaches that might explain discrepancies

    • Consider temporal aspects: acute versus chronic manipulations of Nkain4

    • Evaluate whether conflicting findings measure different functional outcomes

    • Assess whether studies addressed direct versus indirect effects

  • Integrated data analysis:

    • Develop working models that incorporate seemingly contradictory findings

    • Conduct meta-analyses of available data when sufficient literature exists

    • Design experiments specifically aimed at resolving contradictions

What are the key considerations for data reproducibility in Nkain4 research?

To ensure robust, reproducible findings:

  • Reagent considerations:

    • Maintain detailed documentation of antibody sources, catalog numbers, and lots

    • Use consistent cell passage numbers for in vitro experiments

    • Validate recombinant protein batch-to-batch consistency

    • Consider developing standardized reagents for community use

  • Experimental design practices:

    • Include appropriate positive and negative controls in all experiments

    • Perform power analyses to determine adequate sample sizes

    • Blind researchers to experimental conditions when possible

    • Pre-register experimental protocols and analysis plans

  • Data analysis transparency:

    • Clearly describe all data processing steps and exclusion criteria

    • Share raw data through repositories when possible

    • Use consistent statistical approaches with appropriate corrections for multiple testing

    • Consider data visualization standards that accurately represent findings

  • Reporting standards:

    • Adhere to field-specific reporting guidelines

    • Provide detailed methods sufficient for replication

    • Acknowledge limitations and potential confounding factors

    • Present both supporting and contradictory findings

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.