Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1) is an integral membrane protein that forms a crucial component of the Na+/K+-ATPase complex. In mice, this protein belongs to the family of X(+)/potassium ATPases subunit beta proteins, which are evolutionary conserved across species . The mouse Atp1b1 protein functions as the non-catalytic component of the active enzyme complex that catalyzes ATP hydrolysis coupled with the exchange of sodium (Na+) and potassium (K+) ions across plasma membranes . This process is fundamental to establishing and maintaining the electrochemical gradients essential for cellular function.
The full-length mouse Atp1b1 protein spans 304 amino acids and works in concert with a catalytic alpha subunit to form functional heterodimeric complexes . Through the assembly of these alpha/beta heterodimers, Atp1b1 regulates the quantity of sodium pumps transported to the plasma membrane, thus controlling the cell's capacity for ion transport . Beyond its role in ion transport, Atp1b1 has been implicated in cell adhesion mechanisms and the establishment of epithelial cell polarity, highlighting its multifunctional nature .
The electrochemical gradients established and maintained by Na+/K+-ATPase complexes containing Atp1b1 are essential for numerous physiological processes. These include osmoregulation, which maintains cellular volume and prevents lysis or shrinkage in changing osmotic environments . Additionally, these gradients enable sodium-coupled transport of various organic and inorganic molecules, facilitating cellular nutrition and waste removal .
Perhaps most notably, the electrochemical gradients established by Na+/K+-ATPase activity are critical for the electrical excitability of nerve and muscle cells, enabling neural signal transmission and muscular contraction . Research indicates that during embryonic development, the expression of components associated with Na+/K+-ATPase, including the gamma subunit, is essential for acquiring fluid transport capacity, suggesting a developmental role for this enzyme complex .
The recombinant mouse Atp1b1 protein, when produced with a histidine tag, presents a complete amino acid sequence from positions 1 to 304 . The complete amino acid sequence has been characterized as:
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISE LKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKSAQKDDMIFEDC GNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYGKPCIIIKLNRVLGFKPKP PKNESLETYPLTMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYGFPLQYYPYYGKLLQ PKLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS
The protein structure includes features characteristic of membrane proteins adapted for interactions with both the lipid bilayer and the aqueous environments on either side of the membrane. Post-translational modifications, including N-glycosylation, have been identified in the protein, though these are typically reported based on similarity to related proteins rather than direct experimental verification in recombinant preparations . Additionally, glutathionylation has been documented in related forms of the protein, which may influence its functional properties .
When produced as a recombinant protein in expression systems such as Escherichia coli, mouse Atp1b1 typically exhibits the following physical and chemical properties:
The recombinant protein, when properly purified, demonstrates thermal stability at 37°C for at least 48 hours without significant degradation or precipitation, according to accelerated thermal degradation tests . This stability is essential for laboratory applications requiring extended handling periods.
The recombinant mouse Atp1b1 protein is primarily produced using bacterial expression systems, with E. coli being the predominant host organism . The inclusion of a histidine tag facilitates purification through affinity chromatography, enabling the isolation of the protein with purity levels typically exceeding 85-95% . The purified protein is often supplied in lyophilized form, requiring reconstitution before use in experimental applications .
Proper handling of the recombinant protein is essential to maintain its structural integrity and functional properties. Recommended storage conditions include avoiding repeated freeze/thaw cycles, storing at 2-8°C for short-term use (up to one month), and aliquoting and storing at -80°C for long-term preservation (up to 12 months) . These conditions help minimize protein degradation and ensure consistent experimental results.
Recombinant mouse Atp1b1 protein finds applications in numerous laboratory techniques and research paradigms. Based on the available information, documented applications include:
These techniques enable researchers to investigate the expression, regulation, and interaction partners of Atp1b1 in various experimental contexts, advancing our understanding of its cellular functions and potential roles in disease states.
Recent research has identified ATP1B1 as a key copy number driver gene in diffuse large B-cell lymphoma (DLBCL), suggesting its potential involvement in cancer pathogenesis . Studies have demonstrated overexpression of ATP1B1 in DLBCL cell lines compared to normal CD19+ B cells, indicating a possible role in the transformed phenotype of these cancer cells .
The diagnostic and prognostic significance of ATP1B1 in DLBCL has been evaluated using receiver operating characteristic (ROC) curve analysis, which indicated that ATP1B1 could serve as a biomarker for DLBCL diagnosis . Moreover, forest map analyses have suggested that ATP1B1 gene expression levels significantly impact the prognosis of patients with DLBCL .
Time-dependent ROC curve analyses have yielded area under curve (AUC) values of 0.576, 0.663, and 0.706 for 1-year, 3-year, and 5-year survivability, respectively, suggesting increasing prognostic value over time . This pattern indicates that ATP1B1 expression might have particular relevance for long-term outcomes in DLBCL patients.
Experimental studies investigating the functional consequences of ATP1B1 modulation have revealed its significance in various cellular processes relevant to cancer biology. Specifically, downregulation of ATP1B1 has been shown to inhibit DLBCL cell proliferation, migration, invasion, and adhesion . These findings suggest that ATP1B1 may contribute to the aggressive phenotype of DLBCL cells through multiple mechanisms.
Pathway analyses have identified connections between ATP1B1 and focal adhesion processes, providing potential mechanistic insights into how this protein might influence cancer cell behavior . Interestingly, experimental evidence has demonstrated that the enhanced proliferation capacity observed in ATP1B1-overexpressing cells can be reversed with roxithromycin treatment, suggesting potential therapeutic applications .
The identification of ATP1B1 as a key copy number driver gene in DLBCL opens avenues for further investigation into its role in cancer biology and potential as a therapeutic target . Future research might explore the molecular mechanisms through which ATP1B1 influences cell proliferation, migration, and invasion, potentially uncovering novel signaling pathways and interaction partners.
The observed connection between ATP1B1 and focal adhesion processes suggests potential involvement in cell-cell and cell-matrix interactions, which are critical for cancer cell invasion and metastasis . Detailed investigation of these interactions could provide valuable insights into the contribution of ATP1B1 to cancer progression and identify additional therapeutic targets.
The finding that roxithromycin can rescue the enhanced proliferation observed in ATP1B1-overexpressing cells suggests potential for drug repurposing in the treatment of DLBCL and possibly other cancers where ATP1B1 plays a significant role . Additional screening for compounds that modulate ATP1B1 expression or function might identify more potent and specific therapeutic agents.
Given the importance of Na+/K+-ATPase in maintaining cellular homeostasis, therapeutic strategies targeting ATP1B1 would need to carefully consider potential adverse effects. Development of approaches that selectively target cancer cells while sparing normal tissues would be essential for successful translation to clinical applications.
Atp1b1 (ATPase, Na+/K+ transporting, beta 1 polypeptide) is the non-catalytic beta subunit of Na+/K+ ATPase. This enzyme catalyzes ATP hydrolysis coupled with the exchange of Na+ and K+ ions across the plasma membrane. Structurally, the Na+/K+ ATPase consists of a large catalytic alpha subunit and a smaller glycoprotein beta subunit .
The beta subunit regulates the number of sodium pumps transported to the plasma membrane through the assembly of alpha/beta heterodimers . Na+/K+ ATPase-mediated electrochemical gradients are essential for:
Osmoregulation
Sodium-coupled transport of organic and inorganic molecules
Electrical excitability of nerve and muscle tissues
Additionally, Atp1b1 plays roles beyond ion transport, including enhancing virus-triggered induction of interferons and interferon-stimulated genes by promoting ubiquitination of TRAF3 and TRAF6 and phosphorylation of TAK1 and TBK1 .
Atp1b1 demonstrates heterogeneous expression across tissues and cell types:
In the central nervous system, Atp1b1 shows neuronal subtype-specific expression patterns. PV-expressing GABAergic neurons in the hippocampus, somatosensory cortex, and retrosplenial cortex express high levels of Atp1b1 and low levels of Atp1b2 and Atp1b3 . This suggests specialized roles for specific Na+/K+ ATPase subunit combinations in different neuronal populations.
Several experimental models have been developed to investigate Atp1b1 function:
Conditional knockout mouse models:
Circadian regulation models:
Cell culture systems:
Recombinant expression systems:
For in vitro studies, commercially available recombinant Atp1b1 proteins and expression vectors provide valuable tools for studying protein-protein interactions and biochemical properties .
Atp1b1 has emerged as a significant factor in cancer progression and prognosis:
In diffuse large B-cell lymphoma (DLBCL):
Atp1b1 is overexpressed compared to normal CD19+B cells
ROC curve analysis identified Atp1b1 as a potential diagnostic biomarker with AUC values of 0.576, 0.663, and 0.706 for 1-, 3-, and 5-year survivability
Downregulation of Atp1b1 inhibited DLBCL cell proliferation, migration, invasion, and cell adhesion
In cytogenetically normal acute myeloid leukemia (CN-AML):
High Atp1b1 expression predicts adverse prognosis
Atp1b1-high expressers showed upregulation of known unfavorable prognostic biomarkers including ERG, BAALC, MN1, WT1, DNMT3B, TCF4, ITPR2, DNMT3A, SPARC, CXXC5, MAPKBP1, and MIR155HG
Pathway analysis revealed downregulation of apoptotic and natural killer signaling pathways and upregulation of RNA polymerase and CML pathways in Atp1b1-high samples
Association with 50 differentially expressed microRNAs, including miR-146b, miR-125b, miR-100, and miR-155
These findings suggest Atp1b1 could serve as both a diagnostic and prognostic biomarker in hematological malignancies, though its roles may be context-dependent.
Conditional knockout studies have revealed crucial insights into Atp1b1's physiological functions. In lung epithelial cells:
Alveolar fluid clearance (AFC):
Lung permeability and fluid homeostasis:
Epithelial ion transport:
These findings demonstrate that Atp1b1 plays a key role in active ion transport and fluid clearance, with different cell types making distinct contributions to these processes.
A comprehensive analysis of the Atp1b1 protein interactome in alveolar epithelial cells revealed an extensive network of interacting proteins:
Co-immunoprecipitation coupled with mass spectrometry (Co-IP-MS)
Protein-protein interaction (PPI) network construction using STRING database
Functional module analysis using MCODE plugin in Cytoscape
Validation of key interactions by parallel reaction monitoring (PRM)
159 significant proteins were identified as Atp1b1 interactors (fold change >1.5, unique peptide ≥2)
The PPI network consisted of 130 nodes and 1047 edges
Two major functional modules were identified:
Module 1 (score 37): 37 nodes/666 edges, mainly ribosomal proteins (RPS and RPL subunits)
Module 2 (score 6): 6 nodes/15 edges, heat shock proteins (HSPA1A, HSPA5, HSPA8, HSPA9, HSP90AB1, DNAJA1)
Six proteins (HSP90AB1, EIF4A1, TUBB4B, HSPA8, STAT1, PLEC) were validated as key Atp1b1 binding partners
This interactome analysis suggests Atp1b1 participates in protein translation, posttranslational processing, and function regulation beyond its canonical role in ion transport.
Atp1b1 has been identified as a key mediator in the circadian control of blood pressure:
Transcriptional regulation:
Genetic evidence:
Molecular mechanism:
Na+/K+ ATPase activity affects vascular tone and renal sodium handling
In the kidneys, Na+/K+ ATPase regulates blood pressure by controlling sodium reabsorption in renal tubules
In rats of the Milan hypertensive strain (MHS), increased activity and expression of Na-K pump units correlate with hypertension development
Genetic association in humans:
This research establishes a clear molecular pathway connecting the circadian clock system to blood pressure regulation through Atp1b1 expression, providing potential targets for chronotherapeutic approaches to hypertension.
Multiple validated techniques are available for detecting Atp1b1 at both protein and mRNA levels:
In situ hybridization:
RT-PCR and qPCR:
Multiple validated primer sets available from literature
Effective for quantitative analysis across tissues and experimental conditions
For obtaining consistent results, researchers should note that Atp1b1 molecular weight varies across tissues due to post-translational modifications, particularly glycosylation .
Creating conditional knockout models for Atp1b1 requires several key steps:
Generation of floxed Atp1b1 mice (Atp1b1^F/F^):
Insert loxP sites flanking critical exon(s) of the Atp1b1 gene
Validate that the floxed allele maintains normal expression and function
Selection of appropriate Cre driver lines:
Validation of conditional knockout:
Genotyping to confirm floxed allele and Cre transgene presence
RT-PCR/qPCR to verify reduced Atp1b1 mRNA in target tissues
Western blot to confirm protein reduction
Functional assays to demonstrate physiological impact
Experimental considerations:
Include appropriate controls (Cre-negative Atp1b1^F/F^ littermates)
Consider potential developmental compensation mechanisms
Assess for off-target effects of Cre expression
This approach allows cell type-specific investigation of Atp1b1 function while avoiding the potential embryonic lethality of global knockout. Using different Cre lines enables comparing the contribution of Atp1b1 in different cell types to physiological processes, as demonstrated in the lung study where AT1 and AT2 cells contributed 55% and 45% to alveolar fluid clearance, respectively .
When evaluating seemingly contradictory findings regarding Atp1b1 function, researchers should consider:
Tissue and cell-type specificity:
Alpha/beta subunit pairing:
Methodological differences:
Complete knockout vs. partial knockdown reveal different aspects of function
Acute vs. chronic perturbation may lead to different compensatory mechanisms
In vivo vs. in vitro studies may not align due to complex physiological context
Disease-specific contexts:
Interaction networks:
When encountering contradictory results, researchers should carefully evaluate these factors and potentially employ multiple complementary approaches (genetic, biochemical, physiological) in well-defined biological systems to build a more comprehensive understanding of Atp1b1 function.
Recent research has revealed intricate patterns of Atp1b1 expression across neuronal subtypes with significant functional implications:
Expression patterns:
Parvalbumin (PV)-expressing GABAergic neurons in the hippocampus, somatosensory cortex, and retrosplenial cortex express high levels of Atp1b1
These neurons simultaneously express low levels of Atp1b2 and Atp1b3
This distinctive expression pattern correlates with a unique alpha subunit profile: low Atp1a1 and high Atp1a3
Methodological approach:
Functional implications:
Different neuronal subtypes may require specific Na+/K+ ATPase isoform combinations for their unique electrophysiological properties
PV neurons, which are fast-spiking interneurons, may particularly depend on the Atp1a3/Atp1b1 combination
This may explain selective neuronal vulnerability in disorders associated with Na+/K+ ATPase dysfunction
Clinical relevance:
Mutations in ATP1A3 (α3 subunit) cause neurological disorders including rapid-onset dystonia-parkinsonism, alternating hemiplegia of childhood, and CAPOS syndrome
Neurons highly expressing Atp1a3/Atp1b1 may be selectively vulnerable in these conditions
Amyloid β oligomers directly inhibit NAKα3-derived pump activity, potentially linking to neurodegenerative mechanisms
This research provides fundamental information for understanding how specific neuronal populations may be differentially affected in neurological disorders associated with Na+/K+ ATPase dysfunction.
Several genetic variants in ATP1B1 have been associated with human diseases and physiological traits:
Hypertension associations:
The ATP1B1 variant rs2901029 shows significant association with systolic blood pressure (SBP)
Effect size: 1.698 mmHg increase in SBP
Mechanism likely involves altered regulation of renal sodium reabsorption
Previously reported ATP1B1 SNPs (rs3766031, rs12079745, rs1138486) showed larger effect sizes (3.5–5.1 mmHg)
Molecular mechanism in hypertension:
Na+/K+ ATPase influences blood pressure by regulating sodium reabsorption in renal tubules
In the Milan hypertensive strain (MHS) rat model, increased activity and expression of Na-K pump units correlates with hypertension development
The finding of association between ATP1B1 variants and hypertension is consistent with the gene's biological function in sodium handling
Other associated conditions:
These genetic associations provide potential targets for personalized medicine approaches and further mechanistic studies into the role of ATP1B1 in disease pathophysiology.
Emerging research has revealed unexpected roles for Atp1b1 in innate immune responses:
Enhancement of antiviral signaling:
Integration with ion transport function:
The relationship between Atp1b1's canonical ion transport role and its immune functions remains an area of active investigation
Ion balance may influence signaling pathway activity and immune cell function
Cell membrane potential can affect immune receptor clustering and signaling
Research approaches:
Protein interaction studies to identify binding partners in immune signaling pathways
Conditional knockout in immune cell populations
Functional assays measuring interferon production and viral resistance
This novel aspect of Atp1b1 function represents an exciting frontier for understanding the integration of basic cellular processes with immune defense mechanisms.
Studying Atp1b1 within the Na+/K+ ATPase complex presents several technical challenges:
Subunit heterogeneity:
Post-translational modifications:
Membrane protein biochemistry:
As an integral membrane protein, Atp1b1 requires special solubilization conditions
Standard protein analysis techniques may need optimization
Maintaining native conformation during purification is challenging
Functional redundancy:
Specialized physiological assays:
Addressing these challenges requires integrated approaches combining genetic models, biochemical assays, and advanced imaging techniques, often necessitating collaboration between laboratories with complementary expertise.
Quantifying Atp1b1 activity presents unique challenges due to its role as a regulatory subunit rather than the catalytic component. Several approaches can be employed:
Na+/K+ ATPase enzyme activity assays:
Ion flux measurements:
Radioactive tracer studies (^86^Rb+ uptake as K+ surrogate)
Fluorescent ion indicators (SBFI for Na+, PBFI for K+)
Ion-selective electrodes for direct measurement
Electrophysiological approaches:
Physiological function assays:
Surface expression quantification:
The choice of method depends on the specific research question, experimental system, and available equipment. Combining multiple approaches provides the most comprehensive assessment of Atp1b1's functional contribution.