Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1)

Shipped with Ice Packs
In Stock

Description

Molecular Identity and Classification

Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1) is an integral membrane protein that forms a crucial component of the Na+/K+-ATPase complex. In mice, this protein belongs to the family of X(+)/potassium ATPases subunit beta proteins, which are evolutionary conserved across species . The mouse Atp1b1 protein functions as the non-catalytic component of the active enzyme complex that catalyzes ATP hydrolysis coupled with the exchange of sodium (Na+) and potassium (K+) ions across plasma membranes . This process is fundamental to establishing and maintaining the electrochemical gradients essential for cellular function.

The full-length mouse Atp1b1 protein spans 304 amino acids and works in concert with a catalytic alpha subunit to form functional heterodimeric complexes . Through the assembly of these alpha/beta heterodimers, Atp1b1 regulates the quantity of sodium pumps transported to the plasma membrane, thus controlling the cell's capacity for ion transport . Beyond its role in ion transport, Atp1b1 has been implicated in cell adhesion mechanisms and the establishment of epithelial cell polarity, highlighting its multifunctional nature .

Physiological Significance

The electrochemical gradients established and maintained by Na+/K+-ATPase complexes containing Atp1b1 are essential for numerous physiological processes. These include osmoregulation, which maintains cellular volume and prevents lysis or shrinkage in changing osmotic environments . Additionally, these gradients enable sodium-coupled transport of various organic and inorganic molecules, facilitating cellular nutrition and waste removal .

Perhaps most notably, the electrochemical gradients established by Na+/K+-ATPase activity are critical for the electrical excitability of nerve and muscle cells, enabling neural signal transmission and muscular contraction . Research indicates that during embryonic development, the expression of components associated with Na+/K+-ATPase, including the gamma subunit, is essential for acquiring fluid transport capacity, suggesting a developmental role for this enzyme complex .

Protein Structure and Organization

The recombinant mouse Atp1b1 protein, when produced with a histidine tag, presents a complete amino acid sequence from positions 1 to 304 . The complete amino acid sequence has been characterized as:

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISE LKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKSAQKDDMIFEDC GNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYGKPCIIIKLNRVLGFKPKP PKNESLETYPLTMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYGFPLQYYPYYGKLLQ PKLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS

The protein structure includes features characteristic of membrane proteins adapted for interactions with both the lipid bilayer and the aqueous environments on either side of the membrane. Post-translational modifications, including N-glycosylation, have been identified in the protein, though these are typically reported based on similarity to related proteins rather than direct experimental verification in recombinant preparations . Additionally, glutathionylation has been documented in related forms of the protein, which may influence its functional properties .

Physical and Chemical Properties

When produced as a recombinant protein in expression systems such as Escherichia coli, mouse Atp1b1 typically exhibits the following physical and chemical properties:

PropertyValueSource
Molecular Mass30.7 kDa
Protein Length304 amino acids
Expression SystemE. coli
TagHistidine (His)
Purity>85-95%
FormLyophilized in PBS, pH 7.4
Storage BufferPBS containing 5% sucrose, 0.01% sarcosyl

The recombinant protein, when properly purified, demonstrates thermal stability at 37°C for at least 48 hours without significant degradation or precipitation, according to accelerated thermal degradation tests . This stability is essential for laboratory applications requiring extended handling periods.

Recombinant Expression and Purification

The recombinant mouse Atp1b1 protein is primarily produced using bacterial expression systems, with E. coli being the predominant host organism . The inclusion of a histidine tag facilitates purification through affinity chromatography, enabling the isolation of the protein with purity levels typically exceeding 85-95% . The purified protein is often supplied in lyophilized form, requiring reconstitution before use in experimental applications .

Proper handling of the recombinant protein is essential to maintain its structural integrity and functional properties. Recommended storage conditions include avoiding repeated freeze/thaw cycles, storing at 2-8°C for short-term use (up to one month), and aliquoting and storing at -80°C for long-term preservation (up to 12 months) . These conditions help minimize protein degradation and ensure consistent experimental results.

Experimental Applications

Recombinant mouse Atp1b1 protein finds applications in numerous laboratory techniques and research paradigms. Based on the available information, documented applications include:

ApplicationDescriptionSource
SDS-PAGEAnalysis of protein size and purity
Western Blot (WB)Detection and quantification of Atp1b1
ELISAQuantitative measurement of Atp1b1
Immunoprecipitation (IP)Isolation of Atp1b1 and associated proteins

These techniques enable researchers to investigate the expression, regulation, and interaction partners of Atp1b1 in various experimental contexts, advancing our understanding of its cellular functions and potential roles in disease states.

Role in Cancer Biology

Recent research has identified ATP1B1 as a key copy number driver gene in diffuse large B-cell lymphoma (DLBCL), suggesting its potential involvement in cancer pathogenesis . Studies have demonstrated overexpression of ATP1B1 in DLBCL cell lines compared to normal CD19+ B cells, indicating a possible role in the transformed phenotype of these cancer cells .

The diagnostic and prognostic significance of ATP1B1 in DLBCL has been evaluated using receiver operating characteristic (ROC) curve analysis, which indicated that ATP1B1 could serve as a biomarker for DLBCL diagnosis . Moreover, forest map analyses have suggested that ATP1B1 gene expression levels significantly impact the prognosis of patients with DLBCL .

Time-dependent ROC curve analyses have yielded area under curve (AUC) values of 0.576, 0.663, and 0.706 for 1-year, 3-year, and 5-year survivability, respectively, suggesting increasing prognostic value over time . This pattern indicates that ATP1B1 expression might have particular relevance for long-term outcomes in DLBCL patients.

Functional Impact in Cellular Processes

Experimental studies investigating the functional consequences of ATP1B1 modulation have revealed its significance in various cellular processes relevant to cancer biology. Specifically, downregulation of ATP1B1 has been shown to inhibit DLBCL cell proliferation, migration, invasion, and adhesion . These findings suggest that ATP1B1 may contribute to the aggressive phenotype of DLBCL cells through multiple mechanisms.

Pathway analyses have identified connections between ATP1B1 and focal adhesion processes, providing potential mechanistic insights into how this protein might influence cancer cell behavior . Interestingly, experimental evidence has demonstrated that the enhanced proliferation capacity observed in ATP1B1-overexpressing cells can be reversed with roxithromycin treatment, suggesting potential therapeutic applications .

Emerging Research Areas

The identification of ATP1B1 as a key copy number driver gene in DLBCL opens avenues for further investigation into its role in cancer biology and potential as a therapeutic target . Future research might explore the molecular mechanisms through which ATP1B1 influences cell proliferation, migration, and invasion, potentially uncovering novel signaling pathways and interaction partners.

The observed connection between ATP1B1 and focal adhesion processes suggests potential involvement in cell-cell and cell-matrix interactions, which are critical for cancer cell invasion and metastasis . Detailed investigation of these interactions could provide valuable insights into the contribution of ATP1B1 to cancer progression and identify additional therapeutic targets.

Therapeutic Implications

The finding that roxithromycin can rescue the enhanced proliferation observed in ATP1B1-overexpressing cells suggests potential for drug repurposing in the treatment of DLBCL and possibly other cancers where ATP1B1 plays a significant role . Additional screening for compounds that modulate ATP1B1 expression or function might identify more potent and specific therapeutic agents.

Given the importance of Na+/K+-ATPase in maintaining cellular homeostasis, therapeutic strategies targeting ATP1B1 would need to carefully consider potential adverse effects. Development of approaches that selectively target cancer cells while sparing normal tissues would be essential for successful translation to clinical applications.

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please specify them in your order remarks, and we will prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-304aa
Mol. Weight
36.7 kDa
Protein Length
Full Length
Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cancer
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS-
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
This subunit is the non-catalytic component of the active enzyme. It catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates the number of sodium pumps transported to the plasma membrane through the assembly of alpha/beta heterodimers. It is also involved in cell adhesion and establishing epithelial cell polarity.
Gene References Into Functions
  1. FXYD5 mediates metastatic progression through regulation of the beta Na(+)-K(+)-ATPase subunit in the 4T1 mouse breast cancer model. PMID: 28515087
  2. Activities of AE1 and the sodium pump are coregulated in kidney. PMID: 25012180
  3. Atp1b1 was highly expressed in luminal epithelium during peri-implantation and upregulated by progesterone. PMID: 23534996
  4. Beta(1) is the sole expressed beta-subunit in the diaphragm throughout development, and in the hindlimb muscles at birth. PMID: 12397396
  5. The beta1 subunit of the Na/K-ATPase is essential for blastocyst formation and maintaining a normal Na/K-ATPase distribution and localization of tight junction-associated polypeptides during preimplantation development. PMID: 17317668
  6. These data suggest that CLN3 is involved in the regulation of plasma membrane fodrin cytoskeleton, subsequently impacting the plasma membrane association of Na(+), K(+) ATPase. PMID: 18621045
  7. Inhibition of the Atp1b1 isoenzyme of the sodium potassium exchanging ATPase by 8-methoxycoumestrol is reported. PMID: 19487957
  8. Na,K-beta(1) plays a critical role in regulating cardiac contractility, and its loss is associated with significant cardiac pathology. PMID: 19683723

Show More

Hide All

Database Links

KEGG: mmu:11931

STRING: 10090.ENSMUSP00000027863

UniGene: Mm.4550

Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.
Tissue Specificity
Expressed in cardiac muscle and in flexor digitorum brevis (FDB) muscle (at protein level). Expressed in a circadian manner in the kidney and aorta (at protein level).

Q&A

What is the structure and function of Atp1b1 in mouse models?

Atp1b1 (ATPase, Na+/K+ transporting, beta 1 polypeptide) is the non-catalytic beta subunit of Na+/K+ ATPase. This enzyme catalyzes ATP hydrolysis coupled with the exchange of Na+ and K+ ions across the plasma membrane. Structurally, the Na+/K+ ATPase consists of a large catalytic alpha subunit and a smaller glycoprotein beta subunit .

The beta subunit regulates the number of sodium pumps transported to the plasma membrane through the assembly of alpha/beta heterodimers . Na+/K+ ATPase-mediated electrochemical gradients are essential for:

  • Osmoregulation

  • Sodium-coupled transport of organic and inorganic molecules

  • Electrical excitability of nerve and muscle tissues

  • Cell adhesion and establishing epithelial cell polarity

Additionally, Atp1b1 plays roles beyond ion transport, including enhancing virus-triggered induction of interferons and interferon-stimulated genes by promoting ubiquitination of TRAF3 and TRAF6 and phosphorylation of TAK1 and TBK1 .

How is Atp1b1 expressed across different tissues and cell types?

Atp1b1 demonstrates heterogeneous expression across tissues and cell types:

Tissue/Cell TypeAtp1b1 Expression PatternReference
BrainHighly expressed in parvalbumin (PV)-expressing neurons
LungPresent in both alveolar type I (AT1) and type II (AT2) cells
HeartUnder circadian regulation by DEC1 and CLOCK:BMAL1
KidneyDetected as ~55 kDa protein (likely due to glycosylation)
LiverDetected as ~42 kDa protein

In the central nervous system, Atp1b1 shows neuronal subtype-specific expression patterns. PV-expressing GABAergic neurons in the hippocampus, somatosensory cortex, and retrosplenial cortex express high levels of Atp1b1 and low levels of Atp1b2 and Atp1b3 . This suggests specialized roles for specific Na+/K+ ATPase subunit combinations in different neuronal populations.

What experimental models are commonly used to study Atp1b1 function?

Several experimental models have been developed to investigate Atp1b1 function:

  • Conditional knockout mouse models:

    • AT1 cell-specific knockout using Aqp5-cre Atp1b1^F/F^ mice

    • Combined AT1 and AT2 cell knockout using Sftpc-cre Atp1b1^F/F^ mice

  • Circadian regulation models:

    • Dec1-deficient mice (showing enhanced Atp1b1 expression)

    • Clock-mutant mice (showing reduced Atp1b1 expression)

  • Cell culture systems:

    • A549 alveolar epithelial cells for protein interaction studies

    • Mouse alveolar epithelial cell monolayers (MAECM) for electrophysiological studies

    • Cancer cell lines for studying Atp1b1's role in cell proliferation and migration

  • Recombinant expression systems:

    • cDNA expression plasmids available for in vitro and cellular studies

For in vitro studies, commercially available recombinant Atp1b1 proteins and expression vectors provide valuable tools for studying protein-protein interactions and biochemical properties .

What role does Atp1b1 play in cancer and how can it serve as a biomarker?

Atp1b1 has emerged as a significant factor in cancer progression and prognosis:

In diffuse large B-cell lymphoma (DLBCL):

  • Atp1b1 is overexpressed compared to normal CD19+B cells

  • ROC curve analysis identified Atp1b1 as a potential diagnostic biomarker with AUC values of 0.576, 0.663, and 0.706 for 1-, 3-, and 5-year survivability

  • Downregulation of Atp1b1 inhibited DLBCL cell proliferation, migration, invasion, and cell adhesion

  • Pathway analysis linked Atp1b1 to focal adhesion pathways

In cytogenetically normal acute myeloid leukemia (CN-AML):

  • High Atp1b1 expression predicts adverse prognosis

  • Atp1b1-high expressers showed upregulation of known unfavorable prognostic biomarkers including ERG, BAALC, MN1, WT1, DNMT3B, TCF4, ITPR2, DNMT3A, SPARC, CXXC5, MAPKBP1, and MIR155HG

  • Pathway analysis revealed downregulation of apoptotic and natural killer signaling pathways and upregulation of RNA polymerase and CML pathways in Atp1b1-high samples

  • Association with 50 differentially expressed microRNAs, including miR-146b, miR-125b, miR-100, and miR-155

These findings suggest Atp1b1 could serve as both a diagnostic and prognostic biomarker in hematological malignancies, though its roles may be context-dependent.

How does conditional knockout of Atp1b1 impact physiological processes?

Conditional knockout studies have revealed crucial insights into Atp1b1's physiological functions. In lung epithelial cells:

  • Alveolar fluid clearance (AFC):

    • Aqp5-cre Atp1b1^F/F^ mice (AT1 cell-specific knockout) showed 43% reduction in AFC (p=0.006)

    • Sftpc-cre Atp1b1^F/F^ mice (AT1 and AT2 cell knockout) showed 78% reduction in AFC (p=0.002)

    • Analysis indicated AT1 and AT2 cells contribute approximately 55% and 45% to AFC, respectively

  • Lung permeability and fluid homeostasis:

    • No changes in lung permeability to fluorescein-BSA in knockout mice

    • Wet-to-dry lung weight ratios were unchanged

    • Suggests residual Na pump activity is sufficient for baseline fluid homeostasis

  • Epithelial ion transport:

    • Alveolar epithelial cell monolayers from Sftpc-cre Atp1b1^F/F^ mice showed significantly reduced equivalent short-circuit current (IEQ)

    • Transepithelial resistance (RT) remained unchanged

    • Indicates Atp1b1 is crucial for active ion transport but not barrier integrity

These findings demonstrate that Atp1b1 plays a key role in active ion transport and fluid clearance, with different cell types making distinct contributions to these processes.

What is the protein interactome of Atp1b1 and how is it analyzed?

A comprehensive analysis of the Atp1b1 protein interactome in alveolar epithelial cells revealed an extensive network of interacting proteins:

Methodology:

  • Co-immunoprecipitation coupled with mass spectrometry (Co-IP-MS)

  • Protein-protein interaction (PPI) network construction using STRING database

  • Functional module analysis using MCODE plugin in Cytoscape

  • Validation of key interactions by parallel reaction monitoring (PRM)

Key findings:

  • 159 significant proteins were identified as Atp1b1 interactors (fold change >1.5, unique peptide ≥2)

  • The PPI network consisted of 130 nodes and 1047 edges

  • Two major functional modules were identified:

    • Module 1 (score 37): 37 nodes/666 edges, mainly ribosomal proteins (RPS and RPL subunits)

    • Module 2 (score 6): 6 nodes/15 edges, heat shock proteins (HSPA1A, HSPA5, HSPA8, HSPA9, HSP90AB1, DNAJA1)

  • Six proteins (HSP90AB1, EIF4A1, TUBB4B, HSPA8, STAT1, PLEC) were validated as key Atp1b1 binding partners

This interactome analysis suggests Atp1b1 participates in protein translation, posttranslational processing, and function regulation beyond its canonical role in ion transport.

How does Atp1b1 contribute to circadian regulation of blood pressure?

Atp1b1 has been identified as a key mediator in the circadian control of blood pressure:

  • Transcriptional regulation:

    • Atp1b1 expression is regulated by circadian clock proteins DEC1 and CLOCK:BMAL1

    • These factors bind to the CACGTG E-box element in the Atp1b1 promoter

  • Genetic evidence:

    • Dec1-deficient mice showed enhanced Atp1b1 expression in aorta and heart tissues, correlating with reduced blood pressure

    • Clock-mutant mice exhibited reduced Atp1b1 expression and elevated blood pressure

  • Molecular mechanism:

    • Na+/K+ ATPase activity affects vascular tone and renal sodium handling

    • In the kidneys, Na+/K+ ATPase regulates blood pressure by controlling sodium reabsorption in renal tubules

    • In rats of the Milan hypertensive strain (MHS), increased activity and expression of Na-K pump units correlate with hypertension development

  • Genetic association in humans:

    • The ATP1B1 variant rs2901029 is significantly associated with systolic blood pressure (SBP)

    • The observed SBP effect size for rs2901029 was 1.698 mmHg

This research establishes a clear molecular pathway connecting the circadian clock system to blood pressure regulation through Atp1b1 expression, providing potential targets for chronotherapeutic approaches to hypertension.

What are the optimal methods for detecting Atp1b1 in research applications?

Multiple validated techniques are available for detecting Atp1b1 at both protein and mRNA levels:

Protein detection:

MethodRecommended ConditionsDetection NotesReference
Western Blot1:1000-1:8000 antibody dilutionDetects ~42kDa in liver, ~55kDa in kidney
Immunohistochemistry1:20-1:200 antibody dilution; TE buffer pH 9.0 for antigen retrievalValidated in brain and skeletal muscle
Immunofluorescence1:10-1:100 antibody dilutionValidated in HEK-293 cells
Immunoprecipitation0.5-4.0μg antibody for 1.0-3.0mg protein lysateValidated in mouse brain tissue

mRNA detection:

  • In situ hybridization:

    • Validated primers for Atp1b1 (513–1336): 5′-AGCCAAGGAGGAAGGCAG-3′ and 5′-ACGCCTTACACTCGACGC-3′

    • Can be performed with digoxigenin (DIG) or fluorescein (FLU) labeled riboprobes

    • Effective for mapping cellular distribution in tissue sections

  • RT-PCR and qPCR:

    • Multiple validated primer sets available from literature

    • Effective for quantitative analysis across tissues and experimental conditions

For obtaining consistent results, researchers should note that Atp1b1 molecular weight varies across tissues due to post-translational modifications, particularly glycosylation .

How can researchers design conditional knockout models for Atp1b1?

Creating conditional knockout models for Atp1b1 requires several key steps:

  • Generation of floxed Atp1b1 mice (Atp1b1^F/F^):

    • Insert loxP sites flanking critical exon(s) of the Atp1b1 gene

    • Validate that the floxed allele maintains normal expression and function

  • Selection of appropriate Cre driver lines:

    • For alveolar type I cell specificity: Aqp5-cre transgene

    • For both alveolar type I and II cells: Sftpc-cre transgene

    • For neuronal studies: Neuron-specific promoters (e.g., Camk2a-cre, Pvalb-cre)

  • Validation of conditional knockout:

    • Genotyping to confirm floxed allele and Cre transgene presence

    • RT-PCR/qPCR to verify reduced Atp1b1 mRNA in target tissues

    • Western blot to confirm protein reduction

    • Functional assays to demonstrate physiological impact

  • Experimental considerations:

    • Include appropriate controls (Cre-negative Atp1b1^F/F^ littermates)

    • Consider potential developmental compensation mechanisms

    • Assess for off-target effects of Cre expression

This approach allows cell type-specific investigation of Atp1b1 function while avoiding the potential embryonic lethality of global knockout. Using different Cre lines enables comparing the contribution of Atp1b1 in different cell types to physiological processes, as demonstrated in the lung study where AT1 and AT2 cells contributed 55% and 45% to alveolar fluid clearance, respectively .

How should researchers interpret contradictory findings across different Atp1b1 studies?

When evaluating seemingly contradictory findings regarding Atp1b1 function, researchers should consider:

  • Tissue and cell-type specificity:

    • Atp1b1 functions differently in alveolar type I versus type II cells

    • Expression varies significantly across neuronal subtypes

    • Context matters: specify the exact cell types being studied

  • Alpha/beta subunit pairing:

    • Atp1b1 can pair with different alpha subunits (α1, α2, α3)

    • In neurons, PV-expressing cells show a distinct pattern of high Atp1a3/Atp1b1

    • Different subunit combinations may yield different functional properties

  • Methodological differences:

    • Complete knockout vs. partial knockdown reveal different aspects of function

    • Acute vs. chronic perturbation may lead to different compensatory mechanisms

    • In vivo vs. in vitro studies may not align due to complex physiological context

  • Disease-specific contexts:

    • In DLBCL, Atp1b1 appears to promote cancer progression

    • In CN-AML, high Atp1b1 expression correlates with poor prognosis

    • These findings may reflect disease-specific molecular contexts

  • Interaction networks:

    • Atp1b1 interacts with at least 159 proteins in alveolar epithelial cells

    • Perturbations may have ripple effects through multiple pathways

    • Consider secondary effects beyond direct ion transport function

When encountering contradictory results, researchers should carefully evaluate these factors and potentially employ multiple complementary approaches (genetic, biochemical, physiological) in well-defined biological systems to build a more comprehensive understanding of Atp1b1 function.

What is the neuronal subtype-specific expression pattern of Atp1b1 and its implications?

Recent research has revealed intricate patterns of Atp1b1 expression across neuronal subtypes with significant functional implications:

  • Expression patterns:

    • Parvalbumin (PV)-expressing GABAergic neurons in the hippocampus, somatosensory cortex, and retrosplenial cortex express high levels of Atp1b1

    • These neurons simultaneously express low levels of Atp1b2 and Atp1b3

    • This distinctive expression pattern correlates with a unique alpha subunit profile: low Atp1a1 and high Atp1a3

  • Methodological approach:

    • In situ hybridization targeting mRNA coding sequence regions

    • Multiple histochemical labeling to detect co-expression patterns

    • Age-controlled analysis using 8-12 week mice (post-development, pre-aging)

  • Functional implications:

    • Different neuronal subtypes may require specific Na+/K+ ATPase isoform combinations for their unique electrophysiological properties

    • PV neurons, which are fast-spiking interneurons, may particularly depend on the Atp1a3/Atp1b1 combination

    • This may explain selective neuronal vulnerability in disorders associated with Na+/K+ ATPase dysfunction

  • Clinical relevance:

    • Mutations in ATP1A3 (α3 subunit) cause neurological disorders including rapid-onset dystonia-parkinsonism, alternating hemiplegia of childhood, and CAPOS syndrome

    • Neurons highly expressing Atp1a3/Atp1b1 may be selectively vulnerable in these conditions

    • Amyloid β oligomers directly inhibit NAKα3-derived pump activity, potentially linking to neurodegenerative mechanisms

This research provides fundamental information for understanding how specific neuronal populations may be differentially affected in neurological disorders associated with Na+/K+ ATPase dysfunction.

What genetic polymorphisms in ATP1B1 are associated with human disease?

Several genetic variants in ATP1B1 have been associated with human diseases and physiological traits:

  • Hypertension associations:

    • The ATP1B1 variant rs2901029 shows significant association with systolic blood pressure (SBP)

    • Effect size: 1.698 mmHg increase in SBP

    • Mechanism likely involves altered regulation of renal sodium reabsorption

    • Previously reported ATP1B1 SNPs (rs3766031, rs12079745, rs1138486) showed larger effect sizes (3.5–5.1 mmHg)

  • Molecular mechanism in hypertension:

    • Na+/K+ ATPase influences blood pressure by regulating sodium reabsorption in renal tubules

    • In the Milan hypertensive strain (MHS) rat model, increased activity and expression of Na-K pump units correlates with hypertension development

    • The finding of association between ATP1B1 variants and hypertension is consistent with the gene's biological function in sodium handling

  • Other associated conditions:

    • According to GeneCards, ATP1B1 is associated with:

      • Essential hypertension

      • Familial hemiplegic migraine

These genetic associations provide potential targets for personalized medicine approaches and further mechanistic studies into the role of ATP1B1 in disease pathophysiology.

How does Atp1b1 contribute to innate immunity?

Emerging research has revealed unexpected roles for Atp1b1 in innate immune responses:

  • Enhancement of antiviral signaling:

    • Atp1b1 enhances virus-triggered induction of interferons (IFNs) and interferon-stimulated genes (ISGs)

    • Mechanistically, it promotes the ubiquitination of TRAF3 and TRAF6

    • Additionally enhances the phosphorylation of TAK1 and TBK1

    • These pathways are critical for antiviral innate immune responses

  • Integration with ion transport function:

    • The relationship between Atp1b1's canonical ion transport role and its immune functions remains an area of active investigation

    • Ion balance may influence signaling pathway activity and immune cell function

    • Cell membrane potential can affect immune receptor clustering and signaling

  • Research approaches:

    • Protein interaction studies to identify binding partners in immune signaling pathways

    • Conditional knockout in immune cell populations

    • Functional assays measuring interferon production and viral resistance

This novel aspect of Atp1b1 function represents an exciting frontier for understanding the integration of basic cellular processes with immune defense mechanisms.

What technical challenges arise when studying Atp1b1 in the Na+/K+ ATPase complex?

Studying Atp1b1 within the Na+/K+ ATPase complex presents several technical challenges:

  • Subunit heterogeneity:

    • Multiple alpha (α1, α2, α3) and beta (β1, β2, β3) subunit isoforms exist

    • Different alpha-beta combinations may have distinct functional properties

    • Isolating the specific role of Atp1b1 requires careful experimental design

  • Post-translational modifications:

    • Atp1b1 undergoes tissue-specific glycosylation

    • Detected at ~42kDa in liver and ~55kDa in kidney samples

    • These modifications affect antibody recognition and may influence protein function

  • Membrane protein biochemistry:

    • As an integral membrane protein, Atp1b1 requires special solubilization conditions

    • Standard protein analysis techniques may need optimization

    • Maintaining native conformation during purification is challenging

  • Functional redundancy:

    • Other beta subunits may compensate for Atp1b1 loss

    • Even in Atp1b1 knockout models, residual Na pump activity exists

    • This complicates interpretation of knockout/knockdown studies

  • Specialized physiological assays:

    • Functional studies require sophisticated measurements

    • Examples include alveolar fluid clearance, electrophysiological recordings, and ion flux assays

    • These techniques demand specialized expertise and equipment

Addressing these challenges requires integrated approaches combining genetic models, biochemical assays, and advanced imaging techniques, often necessitating collaboration between laboratories with complementary expertise.

How can researchers quantify Atp1b1 activity in different experimental systems?

Quantifying Atp1b1 activity presents unique challenges due to its role as a regulatory subunit rather than the catalytic component. Several approaches can be employed:

  • Na+/K+ ATPase enzyme activity assays:

    • Ouabain-sensitive ATP hydrolysis measurement

    • Colorimetric detection of inorganic phosphate release

    • Requires comparing wild-type vs. Atp1b1-deficient samples to determine contribution

  • Ion flux measurements:

    • Radioactive tracer studies (^86^Rb+ uptake as K+ surrogate)

    • Fluorescent ion indicators (SBFI for Na+, PBFI for K+)

    • Ion-selective electrodes for direct measurement

  • Electrophysiological approaches:

    • Equivalent short-circuit current (IEQ) measurements in epithelial monolayers

    • Whole-cell patch clamp recording of pump currents

    • As demonstrated in mouse alveolar epithelial cell monolayers, Sftpc-cre Atp1b1^F/F^ knockout monolayers showed significantly reduced IEQ compared to control monolayers

  • Physiological function assays:

    • Alveolar fluid clearance (AFC) measurements

    • Blood pressure monitoring in animal models

    • In Aqp5-cre Atp1b1^F/F^ mice, AFC was reduced by 43% compared to controls

    • In Sftpc-cre Atp1b1^F/F^ mice, AFC was reduced by 78%

  • Surface expression quantification:

    • Cell surface biotinylation followed by Western blot

    • Flow cytometry with non-permeabilized cells

    • Immunofluorescence with membrane markers

    • These approaches assess Atp1b1's role in regulating pump trafficking to the plasma membrane

The choice of method depends on the specific research question, experimental system, and available equipment. Combining multiple approaches provides the most comprehensive assessment of Atp1b1's functional contribution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.