Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-3 (Atp1b3)

Shipped with Ice Packs
In Stock

Description

Definition and Molecular Properties

ATP1B3 is a β-subunit of the Na+/K+-ATPase holoenzyme, encoded by the Atp1b3 gene in mice (KEGG: mmu:11933; UniProt: P97370). It forms a heterodimer with the α-subunit to establish Na+ and K+ gradients essential for neuronal signaling, muscle contraction, and osmoregulation .

Key Molecular Features

PropertyDetailSource
GeneAtp1b3 (chromosome 3 in humans, homologous in mice)
Protein Length279 amino acids (human), 277 aa (mouse)
Molecular Weight~28.5 kDa (unmodified), 38–43 kDa (glycosylated)
Transmembrane Domains1 transmembrane region; extracellular immunoglobulin-like domain
Post-Translational ModificationsGlycosylation (N-linked), phosphorylation

Production and Characterization

Recombinant ATP1B3 is produced via heterologous expression systems, with host organisms influencing protein folding, glycosylation, and functional activity.

Production Platforms

Host SystemExpression TagsPurityApplicationsSource
E. coliN-terminal His tag>95%Structural studies
YeastNative (no tag)HighFunctional assays
BaculovirusNative or taggedHighMembrane protein studies
Mammalian cellsNative or taggedHighGlycosylation studies

Example: E. coli-Expressed ATP1B3

  • Sequence Fragment: Met61-Arg277 (partial sequence)

  • Buffer: PBS, pH 7.4, with trehalose and DTT for stabilization

  • Applications: Western blot (WB), SDS-PAGE

Ion Transport and Membrane Integrity

ATP1B3 partners with the α-subunit to form the Na+/K+-ATPase pump, which actively transports 3 Na+ out and 2 K+ into cells. Mutations in Atp1b3 correlate with altered pain sensitivity and glutamate efflux in brain endothelial cells .

Interaction with CASPR1

ATP1B3 binds CASPR1 (contactin-associated protein 1) to regulate Na+/K+-ATPase maturation and trafficking in brain microvascular endothelial cells (BMECs):

  • Mechanism: CASPR1 facilitates ATP1B3 glycosylation and plasma membrane localization .

  • Impact: CASPR1 knockdown reduces ATP1B3 glycosylation, impairing Na+/K+-ATPase activity and glutamate efflux .

Nociceptive Modulation

  • Genetic Studies: Atp1b3 haplotypes influence formalin-induced pain behavior in mice. Silencing ATP1B3 alters strain-specific pain responses .

  • Biophysical Effects: Strain differences in ATP1B3 expression and Na+/K+-ATPase activity correlate with pain sensitivity .

Immune Response

ATP1B3 promotes interferon (IFN) and cytokine (IL-2, IL-4, IL-10) production, enhancing antiviral responses. Overexpression suppresses EV71 virus replication in vitro .

Table 1: ATP1B3 in Disease Models

ModelObserved EffectMechanismSource
EV71 Infection↓ Virus replication with ATP1B3 overexpression↑ IFN-α/β production
Formalin PainAltered nociception in Atp1b3-silenced miceStrain-specific Na+/K+-ATPase activity
Blood-Brain Barrier (BBB)↓ Glutamate efflux in CASPR1/ATP1B3 knockdownImpaired Na+/K+-ATPase trafficking

Table 2: Glycosylation-Dependent Functions

Glycosylation StateConsequenceSource
Fully glycosylatedPlasma membrane localization
Partially glycosylatedER retention (in E. coli)
Non-glycosylatedLoss of function (e.g., BST-2 degradation)

Detection and Quantification

Recombinant ATP1B3 is quantified using ELISA kits with high sensitivity (0.064–0.003 ng/mL) and specificity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
Atp1b3; Sodium/potassium-transporting ATPase subunit beta-3; Sodium/potassium-dependent ATPase subunit beta-3; ATPB-3; CD antigen CD298
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-278
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
GSTHPGKALRKAQQKVLTDASVRLAGTALEGNTFYMENAQPQGGSTSSSPVTLQPNVVYI
Uniprot No.

Target Background

Function
This protein represents the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The precise function of the beta-3 subunit remains unclear.
Gene References Into Functions
  1. These findings highlight that the beta3 subunit of the Na+,K+-ATPase is a novel factor influencing nociceptive sensitivity, further supporting the idea that pain variability genes have selective effects on specific pain modalities.(ATP1BETA3, MOUSE) PMID: 19464798
Database Links

KEGG: mmu:11933

STRING: 10090.ENSMUSP00000034983

UniGene: Mm.424

Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Apical cell membrane; Single-pass type II membrane protein. Basolateral cell membrane; Single-pass type II membrane protein. Melanosome.
Tissue Specificity
Widely expressed.

Q&A

What is the basic function of ATP1B3 in cellular physiology?

ATP1B3 is the β3 subunit of the sodium-potassium pump (Na/K-ATP pump), a critical transmembrane protein complex responsible for maintaining electrochemical gradients across cell membranes. It interacts with the α-subunit ATP1A1 to form a functional complex essential for maintaining cellular homeostasis and membrane potential in all eukaryotic cells . This pump functions by transporting sodium ions out of cells while bringing potassium ions in, consuming ATP in the process. The β-subunit specifically assists in the proper folding, membrane insertion, and stability of the catalytic α-subunit, ensuring proper pump function .

How is ATP1B3 expression regulated at the transcriptional level?

ATP1B3 expression regulation involves tissue-specific mechanisms that differ significantly from its paralog ATP1B1. In hematopoietic lineage cells, ATP1B1 expression is regulated through epigenetic silencing, specifically through histone and DNA methylation in the promoter region . This silencing creates a context where cells become dependent on ATP1B3. Unlike ATP1B1, ATP1B3 maintains expression in these cells, suggesting different regulatory mechanisms govern its transcription. Research methodologies to study this regulation typically involve chromatin immunoprecipitation (ChIP) assays, bisulfite sequencing for DNA methylation analysis, and reporter gene assays to identify transcription factor binding sites.

What are the recommended methods for detecting ATP1B3 protein expression in mouse tissue samples?

For detecting ATP1B3 protein expression in mouse tissue samples, immunohistochemistry (IHC) and Western blotting are the most reliable methods. When performing IHC, tissue fixation in 10% neutral-buffered formalin for 24 hours followed by paraffin embedding is recommended. Antigen retrieval using citrate buffer (pH 6.0) improves detection sensitivity. For Western blotting, tissue homogenization in RIPA buffer containing protease inhibitors, followed by SDS-PAGE separation on 10-12% gels provides optimal results. Commercially available antibodies specifically targeting the mouse ATP1B3 protein should be validated using positive and negative controls. Quantification can be performed using image analysis software such as ImageJ for both IHC and Western blot results, with normalization to housekeeping proteins like β-actin or GAPDH for Western blots.

What are the optimal conditions for recombinant expression of mouse ATP1B3 protein?

The optimal conditions for recombinant expression of mouse ATP1B3 protein involve careful consideration of expression systems, purification methods, and quality control. For mammalian expression, HEK293 or CHO cells typically yield properly folded and post-translationally modified ATP1B3. A C-terminal tag (His or FLAG) is preferable as N-terminal tags may interfere with signal peptide processing. For bacterial expression, E. coli BL21(DE3) with pET vector systems can be used, but requires refolding due to inclusion body formation. Expression should be induced at lower temperatures (16-20°C) with reduced IPTG concentration (0.1-0.5 mM) to enhance solubility.

Purification generally involves a two-step process: affinity chromatography using nickel columns for His-tagged proteins, followed by size exclusion chromatography to enhance purity. For functional studies, co-expression with ATP1A1 is essential as the β-subunit alone may not fold properly. Quality control should include SDS-PAGE analysis, Western blotting, and mass spectrometry to confirm protein identity and purity. Activity assessment requires reconstitution into liposomes and ATPase activity measurements using colorimetric phosphate detection methods.

How can researchers effectively design knockdown/knockout experiments to study ATP1B3 function?

When designing knockdown/knockout experiments for ATP1B3, researchers should consider several methodological approaches. For transient knockdown, siRNA or shRNA targeting at least three different regions of ATP1B3 mRNA is recommended to rule out off-target effects. Typical transfection efficiencies should exceed 70% for reliable results, and knockdown efficiency should be validated by both RT-qPCR and Western blotting.

For stable knockdown or knockout, CRISPR-Cas9 is currently the most efficient method. Design at least three gRNAs targeting early exons of ATP1B3 using prediction tools that minimize off-target effects. Single-cell cloning is essential for generating homogeneous populations, and complete knockout should be verified by sequencing and protein analysis. Since ATP1B3 may be essential in certain cell types, an inducible CRISPR system (Tet-on/off) may be preferable to allow controlled gene deletion.

When studying cell types with potential paralog compensation (ATP1B1), consider double knockdown experiments or use cell lines with naturally low expression of the compensatory paralog . Rescue experiments by reintroducing ATP1B3 or its paralogs are crucial to confirm specificity of the observed phenotypes, as demonstrated in AML studies where reintroducing ATP1B1 rescued the effects of ATP1B3 loss .

What are the established assays for measuring Na/K-ATPase pump activity when studying ATP1B3?

For measuring Na/K-ATPase pump activity in the context of ATP1B3 research, several established assays can be employed. The gold standard is the ouabain-sensitive ATPase activity assay, which measures inorganic phosphate release from ATP hydrolysis. This colorimetric assay utilizes malachite green or molybdate-based detection systems and requires careful sample preparation with membrane fractions containing the pump complex. Activity is calculated as the difference between total ATPase activity and activity in the presence of ouabain (a specific Na/K-ATPase inhibitor).

Alternatively, the rubidium (86Rb+) uptake assay provides a functional measure of pump activity by tracking the cellular uptake of radioactive rubidium, which substitutes for potassium as a substrate for the pump. This assay is particularly valuable for intact cell measurements. For real-time monitoring of pump activity, fluorescent voltage-sensitive dyes like DiBAC4(3) can be used to track membrane potential changes associated with pump function.

When specifically studying ATP1B3's contribution to pump activity, researchers should design experiments that compare wild-type cells with ATP1B3-depleted cells, possibly in backgrounds with low ATP1B1 expression to minimize compensatory effects . Complementation experiments with ATP1B1 can help distinguish between general pump dysfunction and ATP1B3-specific effects, as demonstrated in studies where ATP1B1 overexpression rescued the consequences of ATP1B3 loss .

How does ATP1B3 contribute to leukemia progression and what therapeutic approaches target this mechanism?

ATP1B3 has been identified as a context-specific, paralog-related dependency in acute myeloid leukemia (AML) . In hematopoietic lineage cells, ATP1B1 (a paralog of ATP1B3) is epigenetically silenced through histone and DNA methylation in the promoter region, creating a dependency on ATP1B3 for functional Na/K-ATPase pump activity . Loss of ATP1B3 in AML cells induces cell death in vitro and reduces leukemia burden in vivo through destabilization of the Na/K-ATP pump .

The therapeutic approach targeting this mechanism involves selective inhibition or elimination of ATP1B3 in AML cells. Since normal cells typically express both ATP1B1 and ATP1B3, they have redundancy that protects them from ATP1B3 targeting. In contrast, AML cells with low ATP1B1 expression rely solely on ATP1B3, making them uniquely vulnerable to ATP1B3 inhibition. This creates a therapeutic window based on synthetic lethality principles.

Potential therapeutic strategies include:

  • Development of specific ATP1B3 inhibitors that don't affect other β-subunit isoforms

  • Antisense oligonucleotides or siRNA delivery systems targeting ATP1B3

  • Proteolysis-targeting chimeras (PROTACs) to selectively degrade ATP1B3

  • Small molecules that disrupt the ATP1A1-ATP1B3 interaction

Experimental evidence shows that ATP1B3 loss can be rescued by ATP1B1 overexpression, confirming the mechanism of dependency and providing insights for potential resistance mechanisms that might emerge during therapy .

What is the prognostic significance of ATP1B3 expression in different cancer types?

The prognostic significance by cancer type is summarized in the following table:

Methodologically, researchers can assess ATP1B3 prognostic value in new cancer contexts using Kaplan-Meier survival analysis with log-rank tests, followed by Cox proportional hazards regression for multivariate analysis. RNA-seq data from TCGA and proteomics data from CPTAC provide valuable resources for such analyses .

How does ATP1B3 influence drug resistance in cancer treatment?

ATP1B3 has been implicated in drug resistance mechanisms in cancer treatment, particularly in hepatocellular carcinoma (HCC). Research has shown that HCC patients with sorafenib resistance exhibit significantly higher ATP1B3 expression compared to sorafenib-sensitive patients . This suggests that ATP1B3 may play a role in modulating response to targeted therapies, possibly through its fundamental role in maintaining cellular homeostasis via the Na/K-ATPase pump.

The mechanism by which ATP1B3 contributes to drug resistance may involve several pathways:

  • Altered cellular membrane potential affecting drug uptake or efflux

  • Changes in intracellular ion concentrations that might modify drug binding or activity

  • Activation of downstream signaling pathways that promote cell survival despite drug treatment

  • Potential interaction with drug transporters or metabolism enzymes

Experimental approaches to study this phenomenon include comparing ATP1B3 expression in paired pre- and post-treatment tumor samples, generating drug-resistant cell lines through chronic exposure and analyzing ATP1B3 expression changes, and performing ATP1B3 knockdown or overexpression in resistant cell lines to assess resensitization to treatment.

Interestingly, pharmacological studies have identified that 10 μM and 100 μM progesterone slightly reduces ATP1B3 expression in liver cells, suggesting a potential combined drug strategy with sorafenib for HCC treatment . Additionally, compounds targeting Na/K-ATPase, such as perillyl alcohol (POH), may provide alternative therapeutic approaches for cancers with high ATP1B3 expression .

How do ATP1B3 and its paralog ATP1B1 functionally compensate for each other in different tissues?

The relationship between ATP1B3 and its paralog ATP1B1 demonstrates a fascinating example of contextual gene dependency in mammalian systems. Both proteins function as β-subunits of the Na/K-ATPase pump, but their tissue-specific expression patterns create unique vulnerabilities when one paralog is absent or reduced. In most tissue types, both ATP1B1 and ATP1B3 are expressed at sufficient levels to maintain functional redundancy, allowing either protein to support the α-subunit ATP1A1 in forming a functional pump complex .

  • Loss of ATP1B3 in AML cells with low ATP1B1 expression leads to cell death both in vitro and in vivo models

  • Overexpression of ATP1B1 can rescue the lethal effects of ATP1B3 depletion, confirming functional redundancy when both proteins are present

  • Destabilization of the Na/K-ATP pump occurs specifically when ATP1B3 is eliminated in cells with poor ATP1B1 expression

Methodologically, researchers can study this compensatory relationship using reciprocal knockdown experiments, proteomics to quantify actual protein levels of both paralogs, and rescue experiments with paralog overexpression. Co-immunoprecipitation studies can determine whether both paralogs interact similarly with the α-subunits or have preferential binding partners that might explain tissue-specific functions beyond simple redundancy.

What are the experimental challenges in distinguishing ATP1B3-specific effects from general Na/K-ATPase disruption?

Distinguishing ATP1B3-specific effects from general Na/K-ATPase disruption presents several experimental challenges that require careful methodological approaches. The primary difficulty stems from the functional redundancy within the Na/K-ATPase system, where multiple α and β subunit isoforms can potentially compensate for each other. Additionally, the fundamental nature of Na/K-ATPase function means that its complete disruption has widespread cellular consequences that may mask subunit-specific effects.

To address these challenges, researchers should employ multiple complementary approaches:

  • Paralog-specific targeting: Rather than using general Na/K-ATPase inhibitors like ouabain that affect all pump complexes, use genetic approaches (siRNA, CRISPR) specifically targeting ATP1B3 while monitoring effects on other subunits. This approach should include quantification of all Na/K-ATPase subunits at both mRNA and protein levels following ATP1B3 depletion.

  • Rescue experiments with specificity controls: Perform rescue experiments with both ATP1B3 and other β-subunit paralogs. If a phenotype can be rescued by ATP1B1 but not by mutant versions of ATP1B3, this suggests the effect is related to general pump function rather than an ATP1B3-specific role .

  • Temporal analysis: Use inducible expression/depletion systems to monitor the timeline of effects. ATP1B3-specific functions may manifest before general pump dysfunction occurs.

  • Cell type selection: Choose experimental models with well-characterized expression patterns of Na/K-ATPase subunits. AML cell lines with naturally low ATP1B1 expression offer a clean system for studying ATP1B3-specific effects .

  • Domain swapping: Create chimeric proteins with domains swapped between ATP1B3 and other β-subunits to identify regions responsible for specific functions beyond general pump assembly.

One methodological approach to distinguish between general and specific effects is to compare the transcriptional responses to ATP1B3 depletion versus chemical inhibition of the entire Na/K-ATPase complex, looking for gene signatures unique to ATP1B3 loss.

How can researchers reconcile conflicting data on ATP1B3 expression across different cancer databases?

Reconciling conflicting data on ATP1B3 expression across different cancer databases requires systematic analytical approaches to identify sources of variation and determine which findings are most reliable. The search results highlight some contradictions, particularly in ovarian cancer data where ATP1B3 shows opposite expression patterns in different datasets .

When facing such discrepancies, researchers should consider these methodological approaches:

  • Sample size and statistical power analysis: Evaluate the statistical power of each dataset. The search results note that "contradictory results might be due to the smaller number of control samples in the OV-AU dataset" . Calculate minimum required sample sizes for detecting expression differences with reasonable power (>80%).

  • Metadata harmonization: Compare patient characteristics across datasets, including disease stage, histological subtype, treatment history, and sample collection methods. Differences in these factors may explain contradictory findings.

  • Technical platform comparison: Assess whether differences stem from platform-specific biases by:

    • Comparing data normalization methods used in each dataset

    • Checking probe/primer specificity for microarray or qPCR data

    • Evaluating sequencing depth and coverage for RNA-seq data

    • Examining whether datasets measure mRNA (transcriptomic) or protein (proteomic) levels

  • Validation with orthogonal methods: When databases show conflicting results, validate using alternative techniques:

    • If transcriptomic data conflict, perform RT-qPCR on independent samples

    • Compare mRNA with protein expression using Western blotting or IHC

    • Use single-cell RNA-seq to identify cell type-specific expression that might be masked in bulk tissue analysis

  • Meta-analysis techniques: Apply random-effects models that account for between-study heterogeneity, and perform sensitivity analyses excluding one dataset at a time to identify influential outliers.

A practical example from the search results shows that while ATP1B3 mRNA was higher in ovarian serous carcinoma than normal tissues in TCGA data, the opposite was observed in the OV-AU dataset . This contradiction could be investigated by examining the proportion of specific histological subtypes or tumor microenvironment composition in each dataset.

What are the emerging therapeutic opportunities for targeting ATP1B3 in cancer treatment?

Emerging therapeutic opportunities for targeting ATP1B3 in cancer treatment represent an exciting frontier in precision oncology, particularly for cancers where ATP1B3 dependency has been established. Based on current research, several promising approaches are being developed:

  • Synthetic lethality-based therapies: The identification of ATP1B3 as a selective paralog dependency in AML provides a therapeutic window based on synthetic lethality principles . This approach exploits the fact that cancer cells with low ATP1B1 expression become uniquely dependent on ATP1B3, while normal cells with both paralogs remain protected. Similar dependencies might exist in other cancer types and could be systematically identified through CRISPR-Cas9 screening.

  • Subunit-specific inhibitors: Unlike traditional cardiac glycosides that target the α-subunit of Na/K-ATPase, development of small molecules specifically targeting ATP1B3 could provide cancer-selective effects. Structure-based drug design using crystal structures of the Na/K-ATPase complex can guide the development of compounds that disrupt ATP1B3's interaction with ATP1A1 or its membrane insertion.

  • Targeted protein degradation: Proteolysis-targeting chimeras (PROTACs) designed to induce selective degradation of ATP1B3 represent another promising approach. These bifunctional molecules could link ATP1B3 to E3 ubiquitin ligases, triggering its proteasomal degradation specifically in cancer cells.

  • Combination therapies: Research suggests that ATP1B3 expression is associated with sorafenib resistance in HCC, and preliminary data indicate that progesterone can reduce ATP1B3 expression . This points to potential combination strategies where ATP1B3 inhibition could resensitize resistant tumors to standard therapies.

  • Immunotherapeutic approaches: Given ATP1B3's altered expression in multiple cancers, it could potentially serve as a tumor-associated antigen for CAR-T or vaccine development, particularly in cancers where it is significantly overexpressed compared to normal tissues.

To advance these opportunities, researchers should focus on developing more specific tools to target ATP1B3, establishing pharmacodynamic biomarkers to measure target engagement, and identifying biomarkers (such as ATP1B1 expression levels) to select patients most likely to respond to ATP1B3-targeted therapies.

How can advanced multi-omics approaches enhance our understanding of ATP1B3 biology?

Advanced multi-omics approaches can significantly enhance our understanding of ATP1B3 biology by revealing its complex roles in cellular physiology and disease processes from multiple perspectives. These integrated approaches overcome the limitations of single-omics studies by capturing the interplay between different biological layers.

For ATP1B3 research, several multi-omics strategies show particular promise:

  • Integrative genomics and epigenomics: Combining whole-genome sequencing with ChIP-seq, ATAC-seq, and DNA methylation analysis can reveal the regulatory mechanisms controlling ATP1B3 expression across different tissues. This is particularly relevant given the evidence of epigenetic silencing of ATP1B1 in hematopoietic lineage cells . Such analyses could identify tissue-specific enhancers, repressors, and methylation patterns that explain differential expression of ATP1B3 and its paralogs.

  • Proteomics combined with interactomics: AP-MS (affinity purification-mass spectrometry) or BioID approaches can map the complete interactome of ATP1B3 beyond its canonical interaction with ATP1A1. Quantitative proteomics before and after ATP1B3 depletion can reveal changes in protein abundance and post-translational modifications, providing insights into downstream signaling pathways affected by ATP1B3 function or dysfunction.

  • Metabolomics and fluxomics: Since the Na/K-ATPase pump consumes approximately 30% of cellular ATP and maintains ion gradients critical for numerous metabolic processes, metabolomic profiling coupled with stable isotope labeling can reveal how ATP1B3 perturbation affects cellular metabolism. This could explain why ATP1B3 depletion is particularly lethal in certain cellular contexts.

  • Single-cell multi-omics: Integrating single-cell transcriptomics, proteomics, and functional assays can uncover cell-type-specific dependencies on ATP1B3 and heterogeneity in response to its inhibition. This is particularly relevant for cancer tissues, where subpopulations may exhibit differential ATP1B3 dependency.

  • Spatial transcriptomics and proteomics: These techniques can map ATP1B3 expression and function in the context of tissue architecture, potentially revealing microenvironmental influences on its expression and activity.

Implementation of these approaches requires sophisticated data integration methods, including network analysis, machine learning algorithms, and systems biology modeling to derive meaningful insights from diverse data types. Such integrated analyses could identify novel ATP1B3-dependent pathways that might be exploited therapeutically.

What are the critical experimental controls when studying ATP1B3 function in various model systems?

When studying ATP1B3 function across different model systems, implementing appropriate experimental controls is critical for generating reliable and interpretable data. These controls address the unique challenges associated with ATP1B3 research, including paralog redundancy, essential cellular functions, and potential compensatory mechanisms.

For genetic manipulation experiments (knockdown/knockout):

  • Paralog expression validation: Before interpreting ATP1B3 loss-of-function experiments, quantify expression levels of all Na/K-ATPase β-subunits (ATP1B1, ATP1B2, ATP1B3) at both mRNA and protein levels in your model system. This is essential given the evidence that ATP1B1 can functionally compensate for ATP1B3 loss .

  • Multiple targeting strategies: Use at least two independent methods to target ATP1B3 (e.g., different siRNA sequences, CRISPR guides targeting different exons) to rule out off-target effects.

  • Rescue controls: Include rescue experiments with both wild-type ATP1B3 and, crucially, its paralogs (especially ATP1B1). If phenotypes can be rescued by ATP1B1, the effect likely represents general Na/K-ATPase function rather than an ATP1B3-specific role .

  • Temporal controls: For inducible systems, establish time-course experiments to distinguish immediate direct effects from secondary adaptations.

For biochemical and functional assays:

  • Subunit-specific activity controls: When measuring Na/K-ATPase activity, include controls with specific inhibitors of the pump (e.g., ouabain) to distinguish ATP1B3-dependent activity from background ATPase activity.

  • Cell viability normalization: Since ATP1B3 manipulation may affect cell viability, normalize all functional readouts to viable cell numbers determined by independent assays.

  • Subcellular localization controls: When assessing membrane localization of ATP1B3 or its effect on pump complex assembly, include markers for different cellular compartments (plasma membrane, ER, Golgi) to confirm proper trafficking.

For translational research applications:

  • Tissue-specific controls: When extrapolating findings between different tissues or cancer types, validate the relative expression of ATP1B3 and its paralogs in each specific context. The dependency on ATP1B3 observed in AML may not apply to tissues with different paralog expression patterns .

  • Patient-derived validation: Findings from cell lines should be validated in patient-derived samples whenever possible, with matched normal tissue controls from the same patients or appropriate normal reference tissues.

  • Species-specific considerations: When using mouse models, note that expression patterns of Na/K-ATPase subunits may differ from humans, potentially affecting the translational relevance of findings.

How can researchers interpret contradictory findings regarding ATP1B3 expression in different cancer types?

Interpreting contradictory findings regarding ATP1B3 expression across different cancer types requires a systematic analytical approach that considers various sources of biological and technical variability. The search results highlight some apparent contradictions, such as ATP1B3 being upregulated in some cancers while downregulated in others .

To meaningfully interpret these conflicting findings, researchers should consider:

  • Tissue-specific baseline expression: The normal expression level of ATP1B3 varies considerably across tissue types. Therefore, apparent contradictions may reflect differences in the baseline expression of the reference tissues rather than cancer-specific alterations. Researchers should always compare cancer tissues to the appropriate matched normal tissues rather than to a universal reference.

  • Cancer subtype heterogeneity: Broad cancer classifications (e.g., "ovarian cancer") encompass diverse molecular subtypes with distinct biology. For example, the search results indicate that ATP1B3's significance may vary between different histological grades and stages . Researchers should stratify analyses by established molecular subtypes and histological classifications.

  • Methodological differences across studies: Contradictions may arise from differences in:

    • Detection methods (microarray vs. RNA-seq vs. protein-based methods)

    • Sample processing protocols

    • Bioinformatic pipelines and normalization methods

    • Statistical thresholds for determining significant changes

  • Biological context of ATP1B3 function: ATP1B3's role may be contextually dependent on:

    • The expression pattern of its paralogs, particularly ATP1B1

    • The predominant ATP1A isoforms expressed in the tissue

    • The metabolic state of the cancer cells

    • The tumor microenvironment

  • Dynamic regulation during disease progression: ATP1B3 expression may change during cancer evolution, with different expression patterns in early versus late-stage disease . Longitudinal analyses or careful staging-based comparisons can help resolve apparent contradictions.

A practical analytical framework for reconciling contradictory findings includes:

  • Meta-analysis using random-effects models that account for between-study heterogeneity

  • Forest plots visualizing effect sizes across multiple studies

  • Subgroup analyses based on cancer molecular subtypes

  • Sensitivity analyses that systematically exclude potential outlier studies

  • Funnel plots to assess publication bias favoring positive findings

What methodological considerations explain variability in ATP1B3 functional studies?

Variability in ATP1B3 functional studies can be attributed to several methodological considerations that impact experimental outcomes and interpretations. Understanding these factors is crucial for reconciling apparently conflicting results and designing more robust studies.

  • Cell line selection and authentication: The choice of cell models significantly impacts ATP1B3 functional studies. Different cell lines exhibit varying baseline expression of ATP1B3 and its paralogs, particularly ATP1B1, which can functionally compensate for ATP1B3 loss . Researchers should:

    • Thoroughly characterize the expression profile of all Na/K-ATPase subunits in their model systems

    • Regularly authenticate cell lines to prevent misidentification

    • Consider using isogenic cell line pairs that differ only in ATP1B3 status

  • Knockdown/knockout efficiency and specificity: Variable depletion of ATP1B3 across studies leads to inconsistent results. Critical considerations include:

    • The method of gene targeting (transient siRNA vs. stable shRNA vs. CRISPR-Cas9)

    • Validation of knockdown/knockout at both mRNA and protein levels

    • Assessment of potential compensatory upregulation of other β-subunits

    • Off-target effects of targeting constructs

  • Functional assay selection and standardization: ATP1B3 participates in multiple cellular processes, and different assays may emphasize distinct aspects of its function:

    • Direct Na/K-ATPase activity measurements using biochemical assays

    • Cellular consequences of ATP1B3 loss, including proliferation, migration, and apoptosis

    • Ion homeostasis using fluorescent indicators or electrophysiology

    • Protein-protein interaction studies using various co-IP or proximity labeling approaches

  • Temporal considerations: The timing of analyses following ATP1B3 manipulation greatly influences outcomes:

    • Acute effects may represent direct consequences of ATP1B3 loss

    • Longer-term effects may reflect adaptive responses or secondary consequences

    • The stability of the ATP1B3 protein after genetic manipulation varies across cell types

  • Environmental factors: Experimental conditions impact Na/K-ATPase function and ATP1B3 dependency:

    • Culture medium composition, particularly ion concentrations

    • Serum levels and growth factor signaling

    • Cell density and confluence

    • Oxygen tension and metabolic state

To enhance reproducibility in ATP1B3 functional studies, researchers should:

  • Implement multiple complementary approaches to manipulate and measure ATP1B3 function

  • Include appropriate positive and negative controls for each assay

  • Perform rescue experiments with wild-type and mutant versions of ATP1B3

  • Clearly report all experimental parameters, including cell culture conditions, reagent details, and analytical methods

  • Validate key findings across multiple cell lines or primary cells

How do differences in experimental models affect the translation of ATP1B3 research findings?

Differences in experimental models significantly impact the translation of ATP1B3 research findings from basic science to clinical applications. Understanding these model-specific variations is crucial for accurate interpretation and successful translation of results across research contexts.

  • Species-specific differences in ATP1B3 biology:
    Mouse and human ATP1B3 share approximately 95% amino acid sequence identity, but subtle differences may affect protein-protein interactions, regulatory mechanisms, and functional outcomes. Expression patterns of ATP1B3 and its paralogs vary across species, potentially creating different dependencies and compensatory mechanisms. When translating findings from mouse models to human applications, researchers should validate key observations in human cells or tissues. Humanized mouse models expressing human ATP1B3 may provide more translatable insights for certain research questions.

  • Cell line limitations versus primary cells and tissue models:
    Immortalized cell lines often display altered metabolism and ion regulation compared to primary cells, potentially affecting their dependency on ATP1B3. Cancer cell lines may have accumulated additional genetic alterations that modify ATP1B3 function or importance. Primary cells better reflect physiological conditions but present challenges in terms of limited lifespan and batch variation. Three-dimensional organoid models offer advantages in recapitulating tissue architecture and heterogeneity, providing a platform to study ATP1B3 in more complex cellular environments.

  • Microenvironmental factors across model systems:
    In vitro cultures lack the complex microenvironment of intact tissues, including extracellular matrix components that may interact with Na/K-ATPase complexes. Ion concentrations in standard culture media often differ from tissue interstitial fluid, potentially masking or exaggerating ATP1B3-dependent phenotypes. Oxygen tension varies dramatically between standard cell culture (atmospheric 21%) and physiological conditions (typically 1-5% in tissues), affecting metabolic states and ATP demand. Co-culture systems incorporating multiple cell types can better approximate tissue-level interactions that may influence ATP1B3 function.

  • Temporal dynamics and developmental context:
    Acute genetic manipulation in adult mice or established cell lines may yield different results compared to germline modifications affecting development. The importance of ATP1B3 may vary across developmental stages, with potential compensatory mechanisms more active during development than in adult tissues. Inducible systems allow temporal control of ATP1B3 manipulation but may introduce confounding factors from inducing agents.

To enhance translational relevance, researchers studying ATP1B3 should:

  • Validate key findings across multiple model systems

  • Consider paralog expression profiles when selecting models

  • Use patient-derived models when studying disease relevance

  • Incorporate physiologically relevant microenvironmental conditions

  • Employ both acute and chronic manipulation strategies

  • Clearly acknowledge model-specific limitations when interpreting results

What are the critical quality control parameters for assessing recombinant ATP1B3 protein?

When producing and assessing recombinant ATP1B3 protein for research applications, several critical quality control parameters must be evaluated to ensure reliable experimental outcomes. These parameters span from production to functional assessment of the final product.

  • Purity assessment:
    SDS-PAGE analysis should show a single predominant band at the expected molecular weight (~31-32 kDa for untagged mouse ATP1B3). Silver staining should confirm >95% purity for most applications. Size exclusion chromatography can detect aggregation and provide a secondary purity assessment. Mass spectrometry should confirm protein identity through peptide mass fingerprinting or sequence coverage analysis.

  • Structural integrity:
    Circular dichroism spectroscopy can verify proper secondary structure content. Thermal shift assays (Differential Scanning Fluorimetry) assess protein stability and can be used to optimize buffer conditions. Native PAGE or analytical ultracentrifugation can evaluate oligomeric state. For glycoproteins like ATP1B3, glycosylation patterns should be assessed using specific glycan stains or mass spectrometry.

  • Functional validation:
    Co-immunoprecipitation with ATP1A1 should demonstrate the ability to form a complex with the α-subunit. ATPase activity assays using reconstituted proteoliposomes containing both ATP1A1 and ATP1B3 should show ouabain-sensitive ATP hydrolysis. For studies requiring membrane insertion, proper localization to membrane fractions should be confirmed. Biophysical binding assays (SPR, ITC) can quantify interaction with known binding partners.

  • Endotoxin and contaminant testing:
    Limulus Amebocyte Lysate (LAL) assay should confirm endotoxin levels below 0.1 EU/mg protein for cell-based applications. Mycoplasma testing should be performed when the protein is produced in mammalian expression systems. Host cell protein (HCP) ELISA can quantify residual expression system proteins.

  • Batch consistency:
    Lot-to-lot variation should be assessed using a panel of the above tests. Retention of reference standards from successful batches allows direct comparison. Functional benchmarking against commercial standards (when available) provides additional quality assurance.

Each application may require additional specific quality parameters. For structural studies, homogeneity and monodispersity are critical. For cell-based assays, endotoxin levels and proper folding are paramount. For in vivo applications, additional testing for bioburden, sterility, and stability over time may be necessary.

How can researchers validate ATP1B3 antibody specificity for immunological detection methods?

  • Genetic controls:
    The gold standard for antibody validation is testing in ATP1B3 knockout/knockdown samples. CRISPR-Cas9-mediated knockout cells provide the most definitive negative control. siRNA/shRNA knockdown samples should show reduced signal intensity proportional to knockdown efficiency. Overexpression systems with tagged ATP1B3 can serve as positive controls, allowing comparison of antibody detection with tag-specific antibodies.

  • Peptide competition assays:
    Pre-incubation of the antibody with excess immunizing peptide should abolish specific signals in Western blot, immunohistochemistry, or immunofluorescence. Non-competing peptides from different regions of ATP1B3 or scrambled peptides should not affect antibody binding.

  • Cross-reactivity assessment:
    Testing in systems expressing ATP1B1 and ATP1B2 but not ATP1B3 can evaluate potential cross-reactivity with paralogs. Recombinant proteins of all three β-subunits can be used as parallel controls in Western blots. Antibodies raised against unique regions of ATP1B3 with low sequence homology to other β-subunits may show better specificity.

  • Multi-method concordance:
    Results from different detection methods using the same antibody should show concordance:

    • Western blot should show a single band at the expected molecular weight

    • Immunoprecipitation followed by mass spectrometry should identify ATP1B3

    • Immunofluorescence should show expected subcellular localization (primarily plasma membrane)

    • Results should be consistent across multiple antibodies targeting different epitopes of ATP1B3

  • Species-specific validation:
    When using antibodies across species, validation should be performed in each species of interest. Sequence alignment of the targeted epitope across species can predict potential cross-reactivity issues. For mouse samples, using antibodies raised in species other than mouse reduces background from secondary antibodies.

  • Application-specific validation:
    Each application requires specific validation approaches:

    • For Western blotting: molecular weight, single band, absence in knockout samples

    • For IHC/IF: appropriate subcellular localization, absence of signal in knockout tissues

    • For flow cytometry: comparison with isotype controls, blocking with immunizing peptide

    • For ChIP applications: enrichment of known ATP1B3-associated genomic regions

A systematic validation approach significantly increases confidence in antibody specificity and should be reported in publications to enhance reproducibility of ATP1B3 research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.