Recombinant Mouse Solute carrier family 22 member 3 (Slc22a3)

Shipped with Ice Packs
In Stock

Description

Research Applications

Recombinant Slc22a3 is pivotal in:

  • Drug Transport Studies: Investigating interactions with metformin, melphalan, and other cationic drugs .

  • Neurotransmitter Regulation: Characterizing uptake mechanisms for dopamine, serotonin, and histamine .

  • Disease Modeling: Assessing roles in cancer progression and salt-intake disorders using knockout mice .

Key Functional Insights:

  • Bidirectional Transport: Operates as a voltage-dependent uniporter, independent of Na⁺/Cl⁻ .

  • Substrate Diversity: Transports guanidine, agmatine, and polyamines (e.g., spermidine) .

  • Pathological Relevance: Altered expression in cancers (e.g., colon, breast) and metabolic disorders .

Transport Mechanisms:

  • Electrogenic Activity: Membrane potential drives substrate uptake/release, with high capacity for monoamines .

  • Inhibition Profile: Blocked by corticosteroids and pharmaceuticals (e.g., dexamethasone) .

Disease Associations:

  • Cancer: Downregulated in breast, lung, and ovarian tumors but upregulated in colorectal cancers .

  • Neurological Disorders: Modulates salt-intake behavior and hypothalamic signaling in knockout mice .

Future Research Directions

  • Pharmacogenomics: Impact of SNPs (e.g., rs2048327, rs3088442) on drug efficacy/toxicity .

  • Structural Biology: Cryo-EM studies to resolve substrate-binding domains .

  • Therapeutic Targeting: Developing OCT3-specific inhibitors for metabolic and oncological applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Slc22a3; Oct3; Solute carrier family 22 member 3; Organic cation transporter 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc22a3
Target Protein Sequence
MPTFDQALRKAGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGSQPDYYWCRGPRATALA ERCAWSPEEEWNLTTPELHVPAERRGQGHCHRYLLEATNTSSELSCDPLTAFPNRSAPLV SCSGDWRYVETHSTIVSQFDLVCSNAWMLDLTQAILNLGFLAGAFTLGYAADRYGRLIIY LISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCFVIVTEIVGSKQRRIVGIV IQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYWVVPESPRWLITRKQGEKAL QILRRVAKCNGKHLSSNYSEITVTDEEVSNPSCLDLVRTPQMRKCTLILMFAWFTSAVVY QGLVMRLGLIGGNLYIDFFISGLVELPGALLILLTIERLGRRLPFAASNIVAGVSCLVTA FLPEGIPWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAP FLLFRLAAIWLELPLIIFGILASVCGGLVMLLPETKGIALPETVEDVEKLGSSQLHQCGR KKKTQVSTSDV
Uniprot No.

Target Background

Function
Solute carrier family 22 member 3 (Slc22a3), also known as organic cation transporter 3 (OCT3), is a protein that in humans is encoded by the SLC22A3 gene. OCT3 mediates the potential-dependent transport of various organic cations. It plays a crucial role in the disposition of cationic neurotoxins and neurotransmitters in the brain.
Gene References Into Functions
  1. This research was the first to examine the subcellular localization of OCT3 in any tissue and the first to explore its spatial relationship with synaptic structures in the brain. The study suggests that OCT3 not only contributes to the clearance of extracellular monoamines but also plays a role in their intracellular disposition and action. PMID: 27659446
  2. As metformin undergoes negligible metabolism, these findings indicate that intestinal absorption of metformin is mediated, at least in part, by Oct3 in mice. PMID: 27569291
  3. This study revealed that few, if any, 5-HT neurons in the dorsal raphe are resistant to the loss of Pet-1 for expression of Slc22a3. PMID: 25642596
  4. These findings suggest that OCT3 plays a significant role in the absorption and elimination of metformin and that the transporter is a critical determinant of metformin bioavailability, clearance, and pharmacologic action. PMID: 25920679
  5. These results demonstrate that OCT3 is responsible for metformin accumulation and secretion in salivary glands. PMID: 25107910
  6. Evidence supports a new method of downregulating IL-4 production by basophils, both in vitro and in vivo, through OCT3 targeted by 5-HT and pharmacologic ligands. PMID: 21636115
  7. These results indicate that reduced 5-HT clearance following HPA axis activation is likely mediated, at least in part, by the corticosterone-sensitive OCT3. PMID: 21068324
  8. Slc22a3 is one of three imprinted genes on chromosome 17 that is expressed from the maternal allele. A non-coding Air RNA is required for repression of all three genes on the paternal allele. PMID: 11845212
  9. In 5HT transporter-deficient mice, OCT3 mRNA concentrations were significantly increased in the hippocampus but not in other brain regions. PMID: 12584728
  10. Imprinted silencing of Slc22a3 does not require transcriptional overlap between Igf2r and Air. PMID: 12853484
  11. OCT3 is crucial for balanced neural and behavioral responses to environmentally induced variations in osmolarity and is important for CNS function. PMID: 15028779
  12. STAT3 and Oct3/4, essential transcription factors for ES cell self-renewal, are involved in the regulation of Dax1 expression. PMID: 18471437
  13. OCT3 plays a role in the homeostatic regulation of aminergic neurotransmission in the brain. PMID: 18513366
  14. Findings show that Air interacts with the Slc22a3 promoter chromatin and the H3K9 histone methyltransferase G9a in placenta; Air accumulates at the Slc22a3 promoter in correlation with localized H3K9 methylation and transcriptional repression. PMID: 18988810
  15. Results suggest that organic cation transporter type 3 may be an important transporter mediating serotonergic signaling when serotonin transporter expression or function is compromised. PMID: 19033200
  16. A role of OCT3 in the regulation of fear and anxiety. PMID: 19280114
Database Links
Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in placenta and in kidney cortex, but not in medulla. Low levels found in brain. In the kidney, expressed specifically in the proximal and distal convoluted tubules and within Bowman capsule, but not in the glomerulus.

Q&A

What is Slc22a3 and what are its alternative names in scientific literature?

Slc22a3, also known as Organic Cation Transporter 3 (OCT3) or Extraneuronal Monoamine Transporter (EMT), is a polyspecific membrane transporter encoded by the Slc22a3 gene. This protein belongs to the solute carrier family 22 and functions primarily in the transport of organic cations across cellular membranes . The protein contains twelve putative transmembrane domains and is integrated into the plasma membrane where it facilitates bidirectional transport of various substrates .

What is the structural composition of mouse Slc22a3 protein?

Mouse Slc22a3 is a transmembrane protein consisting of 551 amino acids, containing multiple membrane-spanning domains. The protein's structure includes twelve transmembrane segments with intracellular N and C termini . This architecture is characteristic of the SLC22 family transporters and crucial for its function in facilitating substrate translocation across membranes. In recombinant form, full-length mouse Slc22a3 protein is available with various tags, most commonly His-tag, which facilitates protein purification without significantly interfering with protein function .

What are the primary physiological functions of Slc22a3 in mouse models?

Mouse Slc22a3 functions as a critical transporter for the elimination of endogenous small organic cations, drugs, and environmental toxins . Recent research has revealed its important role in regulating serotonin transport into olfactory bulb astrocytes and coordinating histone serotonylation to regulate gene expression . This transporter appears to be activity-inducible in astrocytes and is required for maintaining astrocyte-neuron communication and olfactory sensory processing . Loss of astrocytic Slc22a3 leads to reduced astrocyte morphological complexity and diminished calcium activity in response to neurotransmitters and neuromodulators .

What are the optimal expression systems for producing functional recombinant mouse Slc22a3?

Several expression systems have proven effective for producing recombinant mouse Slc22a3, each with distinct advantages depending on research requirements:

Expression SystemAdvantagesCommon TagsApplications
E. coliHigh yield, cost-effective, suitable for structural studiesHis-tagProtein-protein interaction studies, antibody production
HEK293 cellsProper folding, post-translational modifications, functional studiesHis, Avi, FcFunctional transport assays, cell-based screens
Mammalian cellsNative-like processing, suitable for functional studiesVariousTransport kinetics, inhibitor screening
Wheat germAlternative for difficult-to-express proteinsNon-taggedStructural analysis

E. coli-expressed full-length mouse Slc22a3 (His-tagged) provides sufficient protein for most biochemical analyses , while mammalian expression systems are preferred when studying transporter function in a cellular context.

What methodological approaches are recommended for studying Slc22a3 transport activity?

For comprehensive characterization of Slc22a3 transport activity, researchers should implement:

  • Radiolabeled substrate uptake assays: Using cells expressing recombinant mouse Slc22a3 to measure the transport of 3H or 14C-labeled substrates under various conditions.

  • Fluorescent substrate transport studies: Employing fluorescent organic cations (e.g., 4-(4-dimethylaminostyryl)-N-methylpyridinium) for real-time visualization of transport activity.

  • Electrophysiological recordings: Applying patch-clamp techniques to measure Slc22a3-mediated currents in response to substrate application.

  • Bidirectional transport assays: Assessing both influx and efflux capabilities using inside-out vesicles or cell models, reflecting Slc22a3's function as a bidirectional transporter .

  • Inhibitor screening: Evaluating pharmaceutical compounds and recreational drugs that potentially modulate Slc22a3 activity .

When conducting these experiments, controlling expression levels and ensuring proper membrane localization are critical factors for obtaining reproducible results.

How does mouse Slc22a3 contribute to neurotransmitter dynamics in the brain?

Recent research demonstrates that mouse Slc22a3 plays a crucial role in regulating serotonin transport into olfactory bulb astrocytes . This transport process coordinates histone serotonylation (H3-5HT), which in turn regulates the expression of astrocytic γ-aminobutyric acid (GABA)-associated genes . This mechanism represents a previously unrecognized pathway by which astrocytes integrate neuromodulator signaling to regulate neurotransmitter release for sensory processing.

Specifically, loss of astrocytic Slc22a3 reduces serotonin levels in astrocytes, leading to alterations in histone serotonylation. Inhibition of histone serotonylation in astrocytes reduces the expression of GABA biosynthetic genes and GABA release, culminating in olfactory deficits . This finding establishes Slc22a3 as a critical component in neuronal-astrocytic communication circuits that regulate sensory processing.

What experimental models are most suitable for investigating Slc22a3's role in neurological function?

For investigating Slc22a3's neurological functions, researchers should consider:

  • Conditional knockout mouse models: Region-specific and cell type-specific deletion of olfactory bulb astrocytic Slc22a3 has proven effective for studying its role in olfactory bulb circuits and odor processing .

  • Astrocyte-neuron co-culture systems: These allow for controlled investigation of Slc22a3-mediated astrocyte-neuron communication dynamics.

  • Calcium imaging techniques: Useful for assessing how Slc22a3 modulates astrocytic calcium responses to neurotransmitters and neuromodulators .

  • Olfactory behavioral paradigms: These provide functional readouts of how Slc22a3 alterations affect sensory processing at the behavioral level.

  • Epigenetic analysis techniques: Necessary for investigating histone serotonylation dynamics influenced by Slc22a3 activity .

When designing these experiments, it's critical to account for potential compensatory mechanisms by other transporters in the SLC22 family.

What is known about Slc22a3's role in cancer biology and how can recombinant Slc22a3 advance this research?

Studies with the human ortholog SLC22A3 have revealed its potential significance in cancer progression. High expression of SLC22A3 is associated with poor prognosis and increased immunogenicity in lung squamous cell carcinoma (LSCC) . SLC22A3 expression positively correlates with immune-related pathways, inflammatory responses, and abundance of infiltrating immune cells in the tumor microenvironment .

Recombinant mouse Slc22a3 can advance cancer research through:

  • Comparative functional studies: Investigating differences between human and mouse orthologs to establish appropriate translational models.

  • Drug transport analysis: Evaluating how Slc22a3 affects the transport and efficacy of anticancer drugs in tumor models.

  • Signaling pathway investigation: Exploring Slc22a3's involvement in choline metabolism in cancer pathways, interacting with proteins like MAPK8, LYPLA1, RALGDS, and others .

For oncology researchers, recombinant full-length mouse Slc22a3 protein (His-tagged) expressed in E. coli offers a valuable tool for developing targeted approaches to modulate transporter activity in cancer contexts .

How does Slc22a3 interact with pharmaceutical compounds, and what implications does this have for drug development?

Slc22a3 functions as a transporter for various pharmaceutical compounds, playing a crucial role in drug distribution, metabolism, and elimination. As a polyspecific organic cation transporter, it handles a wide spectrum of drugs and can be inhibited by both recreational and pharmaceutical compounds .

Key considerations for pharmaceutical researchers include:

  • Drug-drug interaction studies: Assessment of how multiple drugs competing for Slc22a3-mediated transport might affect therapeutic efficacy.

  • Tissue-specific drug distribution: Investigation of how differential expression of Slc22a3 across tissues influences drug bioavailability.

  • Genetic polymorphism effects: Evaluation of how Slc22a3 variants might affect individual responses to drugs that are Slc22a3 substrates.

  • Structure-activity relationship studies: Using recombinant mouse Slc22a3 to identify molecular features that determine substrate specificity and transport efficiency.

When conducting these studies, researchers should consider species differences between mouse and human orthologs, which may affect translational relevance.

What are the recommended approaches for investigating Slc22a3 protein-protein interactions in different cellular contexts?

For comprehensive characterization of Slc22a3 protein-protein interactions, researchers should employ:

  • Co-immunoprecipitation studies: Using purified recombinant mouse Slc22a3 with potential interacting partners, such as the identified interactors ABL1 and NCK1 .

  • Proximity-dependent biotin identification (BioID): Applying this technique to identify proximal proteins in the cellular environment of Slc22a3.

  • Förster resonance energy transfer (FRET): Evaluating direct protein interactions through fluorescently tagged Slc22a3 and partner proteins.

  • Surface plasmon resonance (SPR): Quantifying binding kinetics between purified recombinant Slc22a3 and potential interacting proteins.

  • Yeast two-hybrid screening: Identifying novel interaction partners from various tissue-specific libraries.

These methodologies should be applied with consideration of Slc22a3's transmembrane nature, which can pose challenges for detecting authentic interactions while avoiding artifacts related to hydrophobic regions.

What are the key methodological considerations when studying epigenetic regulation mediated by Slc22a3?

Recent research has uncovered Slc22a3's role in epigenetic regulation through histone serotonylation . When investigating this mechanism, researchers should consider:

  • Chromatin immunoprecipitation (ChIP) assays: For mapping histone serotonylation (H3-5HT) patterns influenced by Slc22a3 activity.

  • Transcriptomic analysis: To identify genes regulated by Slc22a3-mediated histone serotonylation, particularly focusing on GABA-associated genes .

  • Targeted mutagenesis: Using approaches like the mutant histone variant 3.3 (H3.3Q5A) to attenuate astrocytic H3-5HT and assess functional consequences .

  • Pharmacological manipulation: Employing serotonin transport inhibitors to modulate Slc22a3 activity and subsequent epigenetic effects.

  • Single-cell approaches: Analyzing cell-specific effects of Slc22a3-mediated epigenetic changes in heterogeneous tissue environments.

When designing these experiments, researchers should control for potential compensatory mechanisms by other monoamine transporters and consider the temporal dynamics of serotonin transport and subsequent histone modifications.

What are common challenges when working with recombinant mouse Slc22a3 and how can they be addressed?

Working with recombinant membrane proteins like mouse Slc22a3 presents several challenges:

ChallengeSolutionMethodological Approach
Low expression yieldsOptimize codon usage, expression temperature, and induction conditionsTest multiple expression systems (E. coli, HEK293, mammalian cells)
Protein misfoldingUse membrane-mimetic environments during purificationInclude appropriate detergents and lipids during extraction
Functional inactivityEnsure proper membrane insertionValidate localization using microscopy and subcellular fractionation
Aggregation during purificationOptimize detergent selectionScreen detergent panels for optimal solubilization
Instability of purified proteinAdd stabilizing agentsInclude substrate or inhibitor during purification

For functional studies, researchers should verify transporter activity using established substrates before proceeding with novel compound testing.

How should researchers approach experimental design when investigating tissue-specific roles of Slc22a3?

When investigating tissue-specific roles of Slc22a3, researchers should implement:

  • Tissue-specific conditional knockout models: Using Cre-loxP systems targeted to specific cell types, as demonstrated in studies of olfactory bulb astrocytes .

  • Tissue-specific expression analysis: Quantifying Slc22a3 expression levels across different tissues to identify high-expression regions for focused study.

  • Ex vivo tissue preparations: Utilizing acute tissue slices to maintain native cellular architecture while enabling experimental manipulation.

  • Multimodal imaging approaches: Combining techniques like immunofluorescence with functional imaging to correlate Slc22a3 expression with activity.

  • Comparative transport studies: Assessing substrate specificity differences in Slc22a3 derived from different tissues.

Controlling for potential compensatory mechanisms by related transporters (SLC22A1/OCT1 and SLC22A2/OCT2) is essential when interpreting tissue-specific phenotypes resulting from Slc22a3 manipulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.