Recombinant Mouse Solute carrier family 25 member 33 (Slc25a33)

Shipped with Ice Packs
In Stock

Description

Mitochondrial Nucleotide Transport

  • Primary Substrates: Pyrimidine (deoxy)nucleoside di- and triphosphates (e.g., UDP, TTP, CTP) .

  • Mechanism: Antiport-driven exchange of intramitochondrial nucleoside diphosphates for cytosolic triphosphates .

Biological Significance

  • Essential for mitochondrial DNA (mtDNA) and RNA synthesis by supplying nucleotide precursors .

  • Regulates mitochondrial membrane potential and oxidative phosphorylation .

  • Modulates dendritic cell endocytosis and insulin/IGF1-mediated cell proliferation .

Recombinant Expression Systems

Host SystemPurityApplicationsSource
E. coli≥85%Biochemical assays, reconstitution studies
Mammalian cells≥85%Functional studies in native-like environments
AAV vectors (CMV promoter)N/AOver-expression in vivo/in vitro

Transport Kinetics and Inhibition

  • Km Values: Varies by substrate (e.g., higher affinity for triphosphates than diphosphates) .

  • Inhibitors: Mercurial compounds (e.g., mersalyl) and carboxylatractyloside block transport activity .

Regulatory Insights

  • YME1L Protease Dependency: Degraded by YME1L to maintain cytosolic pyrimidine balance; stabilized in Yme1l knockout models .

  • Environmental Stressors: Expression modulated by insulin, mercury chloride, and mitochondrial toxins .

Pathophysiological and Therapeutic Relevance

  • Cancer Research: Proposed as a therapeutic target due to its role in mtDNA maintenance and redox balance .

  • Neurodegeneration: Linked to excitotoxicity resistance via mitochondrial ATP regulation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: Our standard shipping includes normal blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard protocol utilizes a 50% final glycerol concentration, which can serve as a reference for your own procedures.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize its development.
Synonyms
Slc25a33; Solute carrier family 25 member 33
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a33
Target Protein Sequence
MATGTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTIS GAGMVRPTSVTPGLLQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFN GIFVPNSNTVHILSAGSAAFVTNTLMNPIWMVKTRMQLERKVRGCKQMNTLQCARRVYQT EGVRGFYRGLTASYAGISETIICFAIYESLKKCLKDAPIVSSTDGAEKSSSGFFGLMAAA AVSKGCASCIAYPHEVIRTRLREEGSKYRSFVQTARLVFREEGYLAFYRGLFAQLIRQIP NTAIVLSTYEFIVYLLGERA
Uniprot No.

Target Background

Function
Solute Carrier Family 25 Member 33 (Slc25a33) is a mitochondrial transporter responsible for the import/export of pyrimidine nucleotides between mitochondria and the cytoplasm. It exhibits a preference for transporting uracil, thymine, and cytosine (deoxy)nucleoside di- and triphosphates via an antiport mechanism. While it also transports guanine nucleotides, it does not transport adenine (deoxy)nucleotides. Its activity is significantly inhibited by pyridoxal 5'-phosphate, 4,7-diphenyl-1,10-phenanthroline, tannic acid, and mercurials (mercury dichloride, mersalyl acid, p-hydroxymercuribenzoate). Slc25a33 plays a crucial role in mitochondrial genome maintenance, regulation of mitochondrial membrane potential, and mitochondrial respiration. Upon stimulation by insulin (INS) or insulin-like growth factor 1 (IGF1), it regulates cell growth and proliferation by controlling mitochondrial DNA replication and transcription. This, in turn, influences the ratio of mitochondria-to nuclear-encoded components of the electron transport chain, ultimately regulating mitochondrial reactive oxygen species (ROS) production. Slc25a33 also participates in dendritic cell endocytosis and may associate with mitochondrial oxidative phosphorylation.
Gene References Into Functions
  1. Research suggests that PNC1, a gene encoding Slc25a33, is a target of the IGF-I/mTOR pathway. This pathway is essential for mitochondrial activity in regulating cell growth and proliferation. PMID: 17596519
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is mouse Slc25a33 and what is its primary function in mitochondria?

Slc25a33 (also known as PNC1) is a member of the solute carrier family 25, a group of proteins that transport various substrates across the inner mitochondrial membrane. Its primary function is to transport pyrimidine nucleotides, specifically uracil, thymine, and cytosine (deoxy)nucleoside di- and triphosphates by an antiport mechanism . This transport is essential for mitochondrial DNA and RNA synthesis and breakdown .

The protein plays a crucial role in connecting cytosolic and matrix functions by facilitating the import and export of these nucleotides. Studies have demonstrated that Slc25a33 is targeted to mitochondria, confirming its localization to this organelle . Its importance is underscored by studies showing that knockdown of SLC25A33 in human cells causes depletion of mitochondrial DNA, reduced oxidative phosphorylation, decreased cell size, lowered mitochondrial UTP levels, and increased reactive oxygen species levels .

How does Slc25a33 differ functionally from Slc25a36?

Both Slc25a33 and Slc25a36 are mitochondrial transporters for pyrimidine nucleotides, but they exhibit distinct transport properties:

CharacteristicSlc25a33Slc25a36
SubstratesUracil, thymine, and cytosine (deoxy)nucleoside di- and triphosphatesCytosine and uracil (deoxy)nucleoside mono-, di-, and triphosphates
Transport mechanismAntiportBoth uniport and antiport
Initial transport rate measurementAfter 1.5 min (in the initial linear range)After 3 min (in the initial linear range)
Guanine nucleotide transportYesYes
Adenine nucleotide transportNoNo

Both carriers are inhibited by mercurial compounds and other inhibitors of mitochondrial carriers to various degrees . The functional diversity between these two transporters suggests complementary roles in maintaining the nucleotide pool within mitochondria for DNA and RNA metabolism.

What expression patterns have been observed for mouse Slc25a33?

In zebrafish, which provides insights into vertebrate expression patterns potentially relevant to mice, slc25a33 is expressed in specific tissues during development, including:

  • Margin

  • Myotome

  • Pharyngeal arch 3-7 skeleton

The gene is predicted to be active in mitochondria, specifically in the mitochondrial inner membrane . Understanding the expression pattern in mice requires tissue-specific analysis using techniques such as quantitative PCR, in situ hybridization, or immunohistochemistry with specific antibodies against Slc25a33. These expression patterns can provide valuable insights into the tissue-specific roles of this transporter.

What basic methods are used to study Slc25a33 subcellular localization?

Several methodological approaches can be employed to study Slc25a33 subcellular localization:

  • Fluorescent protein fusion: Creating a GFP-Slc25a33 fusion protein allows for visualization of Slc25a33 localization in live cells. This approach has been used to confirm mitochondrial targeting of SLC25A36, and similar approaches have been used for SLC25A33 .

  • Immunofluorescence microscopy: Using specific antibodies against Slc25a33 followed by fluorescent secondary antibodies for visualization in fixed cells.

  • Subcellular fractionation: Isolating mitochondria and other cellular compartments followed by Western blotting to detect Slc25a33 in different fractions.

  • Co-localization studies: Using established mitochondrial markers (e.g., MitoTracker dyes) to confirm the mitochondrial localization of Slc25a33.

When conducting these studies, it's important to include appropriate controls and to validate findings using multiple complementary approaches.

How can recombinant mouse Slc25a33 be purified and reconstituted for transport assays?

The purification and reconstitution of recombinant mouse Slc25a33 involves several critical steps:

  • Gene expression system: The Slc25a33 gene can be cloned into an appropriate expression vector and overexpressed in a suitable host system such as Escherichia coli, as has been done for human SLC25A33 .

  • Protein purification protocol:

    • Bacterial cells expressing Slc25a33 are harvested and lysed

    • The protein is solubilized using appropriate detergents

    • Purification is performed using affinity chromatography (if a tag is present) or ion exchange chromatography

    • Further purification steps may include size exclusion chromatography to obtain highly pure protein

  • Reconstitution into liposomes:

    • Prepare liposomes using appropriate phospholipids (e.g., egg yolk phospholipids)

    • Mix purified Slc25a33 with liposomes in the presence of detergent

    • Remove detergent by dialysis or using Bio-Beads

    • For SLC25A33, buffer A (containing 10 mM NaCl, 10 mM pipes, pH 7.0) has been used for reconstitution

  • Transport assay setup:

    • Load proteoliposomes with specific substrates (e.g., 2 mM substrate)

    • Add radioactive substrate externally (e.g., 5 μM)

    • Measure uptake by removing external radioactivity using a Sephadex G-75 column

    • Calculate initial transport rates from radioactivity taken up by proteoliposomes after appropriate time points (e.g., 1.5 min for SLC25A33)

This methodological approach allows for precise characterization of transport properties, substrate specificity, and kinetic parameters of Slc25a33.

What are the effects of Slc25a33 knockout on mitochondrial function and cellular metabolism?

Knockout of Slc25a33 has several significant effects on mitochondrial function and cellular metabolism, providing insights into its physiological role:

  • Mitochondrial DNA maintenance: Knockdown of SLC25A33 in human cells causes depletion of mitochondrial DNA, indicating its essential role in mtDNA replication or repair .

  • Oxidative phosphorylation: SLC25A33 knockdown results in reduced oxidative phosphorylation, suggesting impaired energy production .

  • Nucleotide pools: Decreased mitochondrial UTP levels are observed in SLC25A33-depleted cells, confirming its role in pyrimidine nucleotide transport .

  • Reactive oxygen species (ROS): Increased ROS levels are detected upon SLC25A33 knockdown, indicating disturbed mitochondrial function .

  • Cell size: SLC25A33 knockdown leads to reduced cell size, whereas overexpression enhances cell size, suggesting a role in cellular growth regulation .

These effects highlight the importance of Slc25a33 in maintaining mitochondrial function and cellular homeostasis. Researchers investigating Slc25a33 knockout models should consider assessing these parameters using techniques such as mtDNA quantification, respirometry, nucleotide measurement by HPLC or mass spectrometry, ROS detection assays, and cell size analysis.

How can CRISPR-Cas9 be utilized to study Slc25a33 functional interactions?

CRISPR-Cas9 technology offers powerful approaches to study Slc25a33 functional interactions:

  • Single gene knockout: Generate Slc25a33 knockout cell lines using CRISPR-Cas9 by designing guide RNAs targeting exonic regions of Slc25a33.

  • Combinatorial knockout screening: This approach can reveal genetic interactions between Slc25a33 and other genes. For example, a dual Cas9 enzyme-based knockout strategy has been employed to probe all 53 human SLC25 family members in a pair-wise manner in pooled format . This system utilizes different PAM sequences recognized by Streptococcus pyogenes Cas9 (SpCas9) versus Staphylococcus aureus Cas9 (SaCas9), enabling simultaneous knockout of two genes .

  • GxGxE interaction analysis: Gene-by-gene-by-environment interaction studies can be performed by screening Slc25a33 knockout cells under different metabolic conditions. This approach has revealed condition-specific genetic interactions among SLC25 transporters .

  • Domain-specific mutagenesis: CRISPR-Cas9 combined with homology-directed repair can be used to introduce specific mutations in functional domains of Slc25a33 to study structure-function relationships.

  • CRISPRi/CRISPRa: These techniques allow for tunable repression or activation of Slc25a33 expression, enabling dosage-dependent studies.

When designing CRISPR-Cas9 experiments for Slc25a33, researchers should consider:

  • Including appropriate control guides targeting non-essential genes

  • Validating knockout efficiency using protein detection methods

  • Performing rescue experiments to confirm phenotype specificity

  • Testing multiple guide RNAs to minimize off-target effects

What structural features determine substrate specificity in Slc25a33?

The substrate specificity of Slc25a33 is determined by specific structural features within its protein sequence:

  • Transmembrane domains: Like other members of the SLC25 family, Slc25a33 contains six transmembrane helices that form a barrel with a central cavity for substrate translocation.

  • Substrate binding site: Research on related SLC25 carriers has identified conserved residues that determine substrate specificity. For instance, studies on SLC25A15 (ORNT1) identified critical arginine (R) and glutamate (E) residues for binding Cα-carboxylate and amino groups in amino acids .

  • Conservation analysis: Alignment of SLC25A33 sequences across species reveals highly conserved residues that may be involved in substrate binding. In human SLC25A39, which is another member of the family, conserved Arg225 and Asp226 residues have been identified as potentially important for substrate binding .

  • Model prediction: Structural modeling based on known structures of other mitochondrial carriers, such as the adenine nucleotide translocase (ANT), can help identify residues in Slc25a33 that face the central cavity and may participate in substrate binding .

To experimentally determine which residues are important for substrate specificity, site-directed mutagenesis followed by transport assays in reconstituted liposomes can be performed. Key residues can be mutated and the effects on transport kinetics and substrate selectivity can be measured.

How does Slc25a33 function interact with mitochondrial dynamics and inflammation?

The intersection between Slc25a33 function, mitochondrial dynamics, and inflammation represents an emerging area of research:

  • Mitochondrial morphology: Mitochondrial dynamics (fusion and fission) is governed by GTPases including MFN1/2, OPA1 (fusion) and DRP1, FIS1, MFF, MID49/51 (fission) . While direct evidence linking Slc25a33 to these processes is limited, disruptions in nucleotide transport could potentially affect mitochondrial morphology by influencing mtDNA maintenance.

  • Sterile inflammation: Disruption of mitochondrial dynamics can trigger sterile inflammatory responses through mitochondrial DNA recognition by intracellular DNA sensors like TLR9 or cGAS . As Slc25a33 is involved in mitochondrial nucleotide transport and mtDNA maintenance, its dysfunction might contribute to mtDNA-mediated inflammatory responses.

  • Metabolic stress: Under metabolic stress conditions, the role of Slc25a33 may become more pronounced. Studies have shown that different metabolic conditions can reveal context-specific functions of mitochondrial transporters .

  • Research approaches: To investigate these interactions, researchers could:

    • Analyze mitochondrial morphology in Slc25a33-deficient cells using confocal microscopy

    • Measure inflammatory markers (cytokines, activation of NF-κB pathway) in response to Slc25a33 knockdown

    • Examine mtDNA release to the cytosol in Slc25a33-deficient cells

    • Assess the activation of DNA sensors (TLR9, cGAS) in the absence of Slc25a33

    • Study the effects of different metabolic conditions on these processes

Understanding these interactions could provide insights into the role of Slc25a33 in cellular stress responses and inflammatory conditions.

What are the common challenges in expressing and purifying recombinant Slc25a33?

Researchers working with recombinant Slc25a33 may encounter several challenges during expression and purification:

  • Protein solubility: As a membrane protein, Slc25a33 can be difficult to solubilize while maintaining its native conformation. Using appropriate detergents (e.g., n-dodecyl-β-D-maltoside, digitonin, or Triton X-100) at optimal concentrations is crucial.

  • Expression levels: Mitochondrial carriers often express poorly in heterologous systems. Strategies to improve expression include:

    • Optimizing codon usage for the expression host

    • Using strong, inducible promoters

    • Testing different expression hosts (E. coli, yeast, insect cells)

    • Lowering induction temperature to slow protein production and improve folding

  • Purification yield: Losses during purification can be significant. To improve yield:

    • Optimize detergent concentration during extraction and purification

    • Use affinity tags (His, GST, etc.) for efficient purification

    • Minimize the number of purification steps

    • Include protease inhibitors to prevent degradation

  • Protein stability: Maintaining stability during purification is challenging. Consider:

    • Adding stabilizing agents (glycerol, specific lipids)

    • Keeping samples cold throughout the process

    • Minimizing exposure to air/oxidation

    • Adding reducing agents if appropriate

  • Reconstitution efficiency: When reconstituting into liposomes, the protein may not incorporate efficiently or in the correct orientation. Optimization strategies include:

    • Adjusting protein-to-lipid ratios

    • Testing different lipid compositions

    • Optimizing detergent removal methods

    • Verifying incorporation using protease protection assays or freeze-fracture electron microscopy

Careful optimization of these parameters is essential for successful expression, purification, and functional reconstitution of Slc25a33.

How can researchers validate the specificity of antibodies against mouse Slc25a33?

Validating antibody specificity is crucial for reliable detection of Slc25a33. Researchers should implement the following strategies:

  • Knockout/knockdown controls:

    • Test antibodies on samples from Slc25a33 knockout mice or cells

    • Use siRNA or shRNA to knockdown Slc25a33 and compare antibody signal with control samples

    • The absence or significant reduction of signal in these samples indicates specificity

  • Overexpression controls:

    • Test antibodies on cells overexpressing tagged Slc25a33

    • Perform dual labeling with antibodies against the tag and against Slc25a33

    • Co-localization indicates antibody specificity

  • Peptide competition assay:

    • Pre-incubate the antibody with excess immunizing peptide

    • Compare staining/blotting with and without peptide competition

    • Specific signal should be blocked by peptide pre-absorption

  • Cross-reactivity assessment:

    • Test antibodies against related proteins (e.g., other SLC25 family members)

    • Examine tissues/cells known to lack Slc25a33 expression

    • Ensure signal is present only in expected locations

  • Multiple antibody validation:

    • Compare results using antibodies raised against different epitopes of Slc25a33

    • Consistent results with different antibodies increase confidence in specificity

  • Mass spectrometry validation:

    • Perform immunoprecipitation followed by mass spectrometry analysis

    • Confirm that Slc25a33 is the major protein pulled down by the antibody

Thorough validation using multiple approaches provides confidence in antibody specificity and ensures reliable experimental results.

What techniques are most effective for measuring Slc25a33 transport activity in intact cells?

Measuring Slc25a33 transport activity in intact cells presents challenges due to its mitochondrial localization. Several approaches can be employed:

  • Radioisotope-labeled substrate uptake:

    • Isolate intact mitochondria from cells

    • Incubate with radioactively labeled pyrimidine nucleotides

    • Measure uptake over time using scintillation counting

    • Compare uptake between wild-type and Slc25a33-deficient cells

  • Fluorescent nucleotide analogs:

    • Use fluorescently labeled nucleotide analogs that can be transported by Slc25a33

    • Monitor accumulation in mitochondria using confocal microscopy or flow cytometry

    • Confirm specificity by competing with unlabeled substrates

  • HPLC or LC-MS/MS analysis:

    • Isolate mitochondria from cells with normal or altered Slc25a33 expression

    • Extract and quantify nucleotide content using HPLC or LC-MS/MS

    • Differences in mitochondrial nucleotide levels reflect transport activity

  • Genetically encoded sensors:

    • Develop mitochondrially targeted nucleotide sensors based on fluorescent proteins

    • Monitor changes in nucleotide levels in real-time in living cells

    • Compare responses in control and Slc25a33-deficient cells

  • Mitochondrial swelling assays:

    • Isolated mitochondria swell when substrates are transported, changing light scattering

    • Measure changes in absorbance upon addition of Slc25a33 substrates

    • Compare between wild-type and Slc25a33-deficient mitochondria

Each method has advantages and limitations, and combining multiple approaches provides more robust evidence of Slc25a33 transport activity in the cellular context.

How should researchers analyze kinetic data from Slc25a33 transport assays?

Proper analysis of kinetic data from Slc25a33 transport assays involves several key steps:

  • Initial rate determination:

    • Measure substrate uptake at multiple time points

    • Identify the linear phase of uptake (typically early time points)

    • For SLC25A33, measurement after 1.5 minutes has been used to determine initial rates

    • Plot initial rates versus substrate concentration

  • Kinetic parameter calculation:

    • Fit data to appropriate kinetic models (e.g., Michaelis-Menten, Hill equation)

    • Calculate Km (substrate concentration at half-maximal transport rate) and Vmax (maximal transport rate)

    • For transporters with multiple substrates, consider competitive kinetics models

  • Transport mechanism analysis:

    • Distinguish between uniport (one-way transport) and antiport (exchange) mechanisms

    • For antiport, perform efflux measurements by preloading proteoliposomes with substrate

    • SLC25A33 has been shown to function via an antiport mechanism

  • Inhibition studies:

    • Measure transport in the presence of various inhibitors

    • Calculate IC50 values (inhibitor concentration that reduces transport by 50%)

    • Plot inhibition data using appropriate models (competitive, non-competitive, etc.)

    • SLC25A33 is inhibited by mercurial compounds and other mitochondrial carrier inhibitors

  • Data visualization and statistical analysis:

    • Present data as mean ± standard deviation from multiple independent experiments

    • Use appropriate statistical tests to compare conditions

    • Include controls (e.g., non-functional mutants, empty liposomes)

Example table format for presenting kinetic parameters:

ParameterSubstrateValueUnitsConditions
KmUTPX ± YμMpH 7.0, 25°C
VmaxUTPX ± Ynmol/min/mg proteinpH 7.0, 25°C
IC50Mercurial compoundX ± YμMpH 7.0, 25°C

Careful analysis and interpretation of kinetic data provides valuable insights into the transport properties and physiological role of Slc25a33.

What are the most informative comparative analyses between mouse and human SLC25A33?

Comparative analyses between mouse and human SLC25A33 can provide valuable insights into evolutionary conservation and species-specific functions:

  • Sequence alignment and homology analysis:

    • Compare protein sequences using multiple sequence alignment tools

    • Calculate sequence identity and similarity percentages

    • Identify conserved domains, particularly those involved in substrate binding

    • Mouse and human SLC25 family members typically show high sequence conservation, suggesting functional similarity

  • Structural comparison:

    • Generate homology models for both mouse and human SLC25A33

    • Compare predicted structures, focusing on the substrate-binding pocket

    • Identify any species-specific structural features

  • Expression pattern comparison:

    • Compare tissue-specific expression profiles across species

    • Analyze developmental expression patterns

    • Identify any species-specific expression differences that might indicate specialized functions

  • Functional comparison:

    • Compare substrate specificity and transport kinetics

    • Examine differences in regulation (e.g., response to metabolic conditions)

    • Test for complementation (can human SLC25A33 rescue mouse Slc25a33 deficiency?)

  • Physiological role comparison:

    • Compare phenotypes of knockout models

    • Analyze cellular responses to deficiency or overexpression

    • Examine interaction networks in both species

Such comparative analyses can help identify conserved functions that are likely fundamental to all mammals, as well as species-specific adaptations that may complicate the translation of mouse research findings to human applications.

How are CRISPR screens revealing new functional insights about Slc25a33 and other SLC25 family members?

Recent CRISPR-based screening approaches are providing unprecedented insights into Slc25a33 and other SLC25 family members:

  • Combinatorial CRISPR screening:

    • Dual Cas9 enzyme-based knockout strategies enable simultaneous knockout of two genes

    • This approach has been used to probe all 53 human SLC25 family members in a pair-wise manner

    • The system utilizes different PAM sequences recognized by Streptococcus pyogenes Cas9 (SpCas9) versus Staphylococcus aureus Cas9 (SaCas9)

  • Gene-by-environment interactions:

    • CRISPR screens in different media conditions have uncovered metabolic regulation of SLC25 transporters

    • For example, SLC25A32 knockout cells show fitness defects that can be buffered in galactose conditions due to substrate limitation in de novo purine biosynthesis

    • Similar approaches could reveal condition-specific functions of Slc25a33

  • Genetic interaction networks:

    • CRISPR screens have identified previously unknown interactions between SLC25 family members

    • For instance, SLC25A39 knockout shows a buffering interaction with the knockout of the mitochondrial iron transporter SLC25A37

    • These interactions provide clues about functional relationships and redundancy

  • Novel function discovery:

    • CRISPR screens followed by functional validation have led to identification of new functions

    • For example, SLC25A39 was identified as a mitochondrial transporter for reduced glutathione (GSH)

    • Similar approaches could uncover additional functions of Slc25a33

  • Future directions:

    • Base editing and prime editing CRISPR technologies will enable precise introduction of disease-associated variants

    • CRISPR activation (CRISPRa) and interference (CRISPRi) screens will provide insights into dosage-dependent effects

    • Tissue-specific CRISPR screens in animal models will reveal context-dependent functions

These advanced screening approaches are transforming our understanding of mitochondrial transporters and will continue to reveal new functional insights about Slc25a33 and related proteins.

What is the potential role of Slc25a33 in mitochondrial-nuclear communication and cellular stress responses?

Emerging evidence suggests potential roles for Slc25a33 in mitochondrial-nuclear communication and cellular stress responses:

  • Nucleotide signaling:

    • As a transporter of pyrimidine nucleotides, Slc25a33 may influence nucleotide availability for both mitochondrial and nuclear processes

    • Changes in nucleotide pools can serve as signals that influence gene expression and cellular responses

  • mtDNA maintenance and retrograde signaling:

    • Slc25a33 is essential for mitochondrial DNA maintenance

    • Disruptions in mtDNA can trigger retrograde signaling pathways that alter nuclear gene expression

    • These pathways often involve stress response genes and can influence cellular adaptation

  • Reactive oxygen species (ROS) signaling:

    • Knockdown of SLC25A33 increases ROS levels

    • ROS serve as important signaling molecules that can activate stress response pathways

    • This connection suggests Slc25a33 may indirectly influence redox-sensitive signaling pathways

  • Metabolic stress adaptation:

    • The function of mitochondrial transporters can become particularly important under specific metabolic conditions

    • Slc25a33 may play a role in cellular adaptation to nutrient limitation or other metabolic stresses

  • Potential connection to inflammatory responses:

    • Mitochondrial dysfunction can trigger sterile inflammation through mitochondrial DNA recognition by intracellular DNA sensors like TLR9 or cGAS

    • As Slc25a33 is involved in mtDNA maintenance, it may influence these inflammatory pathways

To investigate these potential roles, researchers could:

  • Analyze transcriptional responses to Slc25a33 manipulation under various stress conditions

  • Examine activation of stress-responsive transcription factors (e.g., NRF2, ATF4)

  • Assess mitochondrial-nuclear communication pathways in Slc25a33-deficient cells

  • Study the role of Slc25a33 in cellular adaptation to various stressors

Understanding these connections could provide insights into the broader physiological significance of Slc25a33 beyond its direct transport function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.