Recombinant Mouse Solute carrier family 25 member 34 (Slc25a34)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare according to your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your usage.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc25a34; Gm1369; Solute carrier family 25 member 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a34
Target Protein Sequence
MKPTQAQMAPAMDSREMVSPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQAPGTY PRPYRGFVSSVAAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLTQQPGGT VVAGAAAGALGAFVGSPAYLVKTQLQAQTVATMAVGHQHQHQGVLSALETIWRQQGMLGL WRGVGGAVPRVTVGSAAQLATFTSAKAWVQDRQWFLEDSWLVTLAGGMISSIAVVAVMTP LDVVSTRLYNQPVDRAGRGQLYGGLADCLVKTCQQEGPLALYKGLGPAYLRLGPHTILSM FFWDELRKLVARAQHQGT
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A34 and what is its cellular localization?

SLC25A34 belongs to the SLC25 carrier family, which consists of 53 transport proteins located in the mitochondrial inner membrane. These proteins function as solute carriers involved in transporting various biomolecules (amino acids, nucleotides, carboxylates, keto acids, and other substrates) across the inner mitochondrial membrane . SLC25A34 is classified as a multi-pass membrane protein that resides in the mitochondrial inner membrane . Despite being identified as part of this family, SLC25A34 is currently considered an "orphan transporter" as its specific substrates and precise function remain uncharacterized . It is grouped within the mitochondrial di- and tri-carboxylic acid transporter subfamily based on sequence homology, though functional confirmation is lacking .

What experimental models are available for studying mouse Slc25a34?

Several experimental models have been developed for studying mouse Slc25a34:

  • Floxed mouse models: Slc25a34 floxed mice have been generated using CRISPR/Cas9 technology following the Easi-CRISPR strategy. This approach involved flanking exon 1 and the promoter with LoxP sites, allowing for conditional deletion .

  • Tissue-specific knockout models: Liver-specific Slc25a34 knockout mice (Slc-HKO) have been created by injecting 2-month-old Slc25a34 floxed mice with AAV8-TBG-Cre virus, which targets >95% of hepatocytes and effectively deletes the gene in liver cells .

  • Recombinant protein resources: For in vitro studies, recombinant mouse SLC25A34 protein pre-coupled to magnetic beads is available. These ready-to-use beads feature uniform particle size (~2 μm) with narrow size distribution and are suitable for applications including immunoassays, cell sorting, immunoprecipitation, and protein purification .

  • Molecular tools: Validation methods for these models include PCR-based genotyping protocols with specific primers that can identify the presence of floxed or deleted alleles through restriction enzyme digestion patterns .

How can researchers verify Slc25a34 knockout or knockdown efficiency?

Verification of Slc25a34 knockout or knockdown can be accomplished through several complementary methods:

  • PCR-based genotyping: DNA can be amplified using specific primers targeting the floxed regions (e.g., F51/R51 for the 5' LoxP site and F32/R32 for the 3' LoxP site), followed by restriction enzyme digestion with EcoR1. For the 5' LoxP site, the wild-type allele generates a 550 bp fragment without an EcoR1 site, whereas the floxed allele generates a 590 bp fragment that yields 230 bp and 260 bp fragments after digestion. Similarly, for the 3' LoxP site, the wild-type allele produces a 515 bp fragment lacking an EcoR1 site, while the floxed allele yields a 555 bp fragment that produces 224 bp and 331 bp fragments after digestion .

  • Transcript analysis: RT-qPCR can be used to quantify Slc25a34 mRNA expression levels in target tissues.

  • Protein detection: Western blotting using antibodies against SLC25A34 can confirm protein deletion in knockout tissues.

  • Functional assessment: Changes in mitochondrial function, particularly aspects of metabolic function that are altered in Slc25a34 knockout models (such as glucose metabolism), can provide functional verification of successful knockout .

  • RNA sequencing: Transcriptomic analysis can not only confirm Slc25a34 deletion but also reveal downstream effects on metabolic pathways, as demonstrated in studies showing altered fatty acid metabolism in knockout models .

What is known about the physiological role of SLC25A34 in hepatocyte metabolism?

Research using liver-specific SLC25A34 knockout models has provided valuable insights into its physiological function:

Experimental ConditionPhenotypic Observations in SLC25A34 KnockoutReference
Chow dietModest effects on liver function, with altered glucose metabolism being the most pronounced defect
2 months on Fast Food Diet (FFD)More severe phenotype: increased lipid content and impaired glucose tolerance
6 months on Fast Food Diet (FFD)Attenuated phenotype compared to 2-month timepoint

RNA-sequencing of Slc25a34 knockout livers revealed significant changes in metabolic processes, particularly fatty acid metabolism . The time-dependent changes in phenotype severity suggest that SLC25A34 deletion initially predisposes the liver to metabolic distress but, surprisingly, accelerates metabolic adaptation over time . These findings indicate that SLC25A34 plays an important role in mitochondrial respiration and bioenergetics during non-alcoholic fatty liver disease (NAFLD) progression . The opposing effects observed with SLC25A34 overexpression further support its direct involvement in regulating liver metabolism .

What methodologies can be employed to identify the substrates of orphan transporters like SLC25A34?

Identifying substrates for orphan transporters like SLC25A34 requires a multi-faceted approach:

  • Traditional in vitro assays: Proteoliposome transport assays have historically been used, though they are low throughput and reliant on labeled substrates . These assays can be subject to issues related to reverse transport and pH gradient relationships.

  • High-throughput screening: More recent approaches include thermostability shift assays to determine novel substrates and regulators of carriers . These methods can identify molecules that stabilize the transporter structure, potentially indicating substrate interactions.

  • Genetic approaches: CRISPR-based screening methods can systematically investigate transporter function by examining the effects of gene knockout on cellular metabolite profiles.

  • Metabolomic analyses: Comparing metabolite profiles between wild-type and knockout models can identify accumulating or depleted compounds that may represent substrates.

  • Structural biology integration: Development of substrate-agnostic, higher-throughput methodologies as mentioned in the literature will have a transformative impact on identifying substrates, agonists, antagonists, and regulators .

  • Multi-disciplinary collaboration: Combining structural biology, biochemistry, and computational approaches offers the most promising strategy for orphan transporter characterization .

How does SLC25A34 contribute to the pathophysiology of metabolic diseases?

Studies using the liver-specific Slc25a34 knockout mouse model have revealed important insights into SLC25A34's role in metabolic disease:

  • Glucose metabolism: Loss of SLC25A34 in hepatocytes leads to altered glucose metabolism, suggesting its involvement in maintaining glucose homeostasis .

  • Lipid metabolism: RNA-sequencing of knockout livers showed changes in fatty acid metabolism pathways. After 2 months on a fast food diet (FFD), knockouts exhibited increased hepatic lipid content compared to controls .

  • Biphasic response to metabolic stress: Intriguingly, SLC25A34's role appears to be time-dependent. Early in FFD feeding (2 months), its absence exacerbates metabolic dysfunction, but this effect is attenuated with prolonged FFD feeding (6 months) .

  • Mitochondrial function: SLC25A34 plays a role in mitochondrial respiration and bioenergetics during non-alcoholic fatty liver disease (NAFLD) , suggesting it may be important for maintaining mitochondrial function under metabolic stress.

  • Potential therapeutic implications: The observed time-dependent effects suggest that modulating SLC25A34 activity might have different outcomes depending on the stage of metabolic disease progression.

To fully elucidate these mechanisms, researchers should consider time-course studies, multi-omics approaches (combining transcriptomics, proteomics, and metabolomics), and investigations in different metabolic disease models beyond NAFLD.

What are the challenges in studying SLC25A34 transport kinetics, and how might these be overcome?

Studying SLC25A34 transport kinetics presents several significant challenges:

Potential solutions include:

  • Substrate-agnostic methods: Developing approaches that can detect transport activity without knowing the specific substrate, such as measuring ion currents or membrane potential changes.

  • Computational modeling: Using homology modeling based on other SLC25 family members with known structures to predict potential substrates and transport mechanisms.

  • Novel screening approaches: High-throughput thermostability shift assays and other innovative methods to identify molecules that interact with the transporter .

  • Collaborative approaches: Combining expertise from structural biology, biochemistry, genetics, and computational science to tackle the problem from multiple angles, as suggested in recent reviews .

How can researchers differentiate between direct effects of SLC25A34 manipulation and compensatory mechanisms?

Distinguishing direct effects from compensatory responses requires strategic experimental design:

  • Temporal analysis: The study showing different phenotypes at 2 versus 6 months on fast food diet demonstrates the importance of time-course experiments in capturing both immediate effects and adaptive responses .

  • Inducible systems: Using inducible knockout or knockdown technologies allows for temporal control of SLC25A34 expression and helps distinguish acute effects from chronic adaptations.

  • Multiple model systems: Comparing effects across different experimental models (cell lines, primary cells, different tissues in vivo) can help identify consistent direct effects versus context-dependent compensatory mechanisms.

  • Molecular profiling: Comprehensive analysis of other mitochondrial transporters and metabolic enzymes can identify compensatory changes in expression or activity following SLC25A34 manipulation.

  • Rescue experiments: Reintroducing wild-type SLC25A34 into knockout models can confirm which phenotypes are directly attributable to its absence.

  • Rapid perturbation approaches: Development of specific inhibitors or degraders would allow for acute inhibition without time for compensatory mechanisms to develop.

What are the practical applications of recombinant mouse SLC25A34 protein?

Recombinant mouse SLC25A34 protein, particularly when pre-coupled to magnetic beads, offers several practical applications for researchers:

  • Immunoassays: The protein can be used in various immunoassay formats to detect and quantify interactions with antibodies or other binding partners .

  • In vitro diagnostics: As a research tool, it can support the development of diagnostic tests related to mitochondrial function or metabolism .

  • Cell sorting: The magnetic bead-coupled protein can be used in cell isolation and sorting applications .

  • Immunoprecipitation/Co-precipitation: This format is particularly valuable for pulling down interaction partners, helping to map the protein interaction network of SLC25A34 .

  • Protein/antibody separation and purification: The magnetic bead format facilitates easy separation and purification of SLC25A34-interacting molecules .

  • High-throughput operations: The uniform particle size and narrow size distribution make these beads compatible with automation equipment for high-throughput applications .

  • Substrate screening: The protein could potentially be used in binding assays to identify candidates for the still-unknown substrates of this orphan transporter.

What approaches can translate findings from mouse Slc25a34 studies to human SLC25A34 function?

Translating findings from mouse models to human relevance requires multiple complementary approaches:

  • Comparative sequence analysis: Assessing conservation between mouse Slc25a34 and human SLC25A34 (304 amino acids, 32224 Da) can identify functionally important domains likely to have conserved roles.

  • Human cell models: Generating SLC25A34 knockdown or overexpression in human cell lines can verify if phenotypes observed in mouse studies are conserved across species.

  • Patient samples: Examining SLC25A34 expression in samples from patients with metabolic disorders, particularly those affecting the liver, can establish clinical relevance of the findings from mouse models.

  • Genetic association studies: Investigating whether SLC25A34 variants in human populations are associated with metabolic phenotypes similar to those observed in mouse models.

  • Functional conservation testing: Determining whether human SLC25A34 can rescue phenotypes in mouse Slc25a34 knockout models would provide strong evidence for functional conservation.

  • Disease modeling: Using patient-derived cells or introducing human disease-associated variants of SLC25A34 into experimental systems can help evaluate pathological relevance.

How can researchers investigate potential functional interactions between SLC25A34 and other mitochondrial transporters?

Investigating functional interactions between SLC25A34 and other mitochondrial transporters requires a multi-faceted approach:

  • Co-immunoprecipitation studies: Using recombinant SLC25A34 protein coupled to magnetic beads can help identify physical interactions with other proteins .

  • Proximity labeling: Techniques such as BioID or APEX can map the protein interaction network of SLC25A34 within the mitochondrial membrane.

  • Genetic interaction studies: Creating double knockout or knockdown models can reveal functional redundancies or synergies between SLC25A34 and other transporters.

  • Metabolic flux analysis: Measuring changes in metabolite movement in cells with modulated expression of multiple transporters can identify functional dependencies.

  • Structural studies: Recent research on other mitochondrial transporters suggests that some function as multiprotein complexes or in coordination with other transporters, such as ABCB8 with the MITOK cation channel . Similar cooperative relationships may exist for SLC25A34.

  • Alternative splicing investigation: Research has shown that alternative splicing can create mitochondrial transporters, as with the SLC1A5 variant identified as a mitochondrial glutamine transporter . Examining potential splice variants of SLC25A34 may reveal additional functions or interactions.

What are the most promising approaches for determining SLC25A34 function?

Based on current knowledge, several approaches show particular promise for elucidating SLC25A34 function:

  • Comprehensive metabolomics: Detailed metabolic profiling of tissues and cells with manipulated SLC25A34 expression, particularly focusing on mitochondrial metabolites and lipid species given the observed effects on glucose and fatty acid metabolism .

  • Tissue-specific knockout models beyond liver: While liver-specific knockouts have provided valuable insights , generating knockout models in other metabolically active tissues could reveal tissue-specific functions.

  • Functional genomics screening: CRISPR-based screens in cellular models can identify genetic interactions and pathways that depend on SLC25A34 function.

  • Novel transport assay development: As highlighted in recent reviews, developing substrate-agnostic, higher-throughput methodologies will be transformative for characterizing orphan transporters like SLC25A34 .

  • Structural biology approaches: Determining the three-dimensional structure of SLC25A34 would provide crucial insights into its function and substrate specificity.

  • Integration with mitochondrial physiology: Detailed analysis of how SLC25A34 affects mitochondrial membrane potential, respiratory capacity, and response to metabolic challenges.

  • Developmental studies: Investigating the role of SLC25A34 during development and under different physiological stresses could reveal context-dependent functions.

What potential disease associations warrant investigation for SLC25A34?

Based on the functional evidence available, several disease associations merit further investigation:

  • Metabolic disorders: Given the role of SLC25A34 in hepatic glucose and lipid metabolism , conditions such as type 2 diabetes, insulin resistance, and metabolic syndrome warrant investigation.

  • Liver diseases: The demonstrated role in non-alcoholic fatty liver disease progression suggests potential involvement in other liver pathologies, including non-alcoholic steatohepatitis (NASH), alcoholic liver disease, and liver fibrosis.

  • Mitochondrial disorders: As a mitochondrial inner membrane protein , SLC25A34 may contribute to diseases characterized by mitochondrial dysfunction.

  • Neurodegenerative diseases: Other SLC25 family members have been implicated in neurological conditions. For example, mutations in SLC25A22 cause neonatal epileptic encephalopathy , suggesting neurological conditions could be investigated for SLC25A34 as well.

  • Cancer metabolism: Given its role in cellular metabolism, potential contributions to altered metabolic states in cancer cells merit exploration.

  • Exercise physiology: The finding that mutations in another SLC25 member cause exercise intolerance suggests investigating SLC25A34's potential role in muscle metabolism and exercise response.

Future genetic association studies, tissue expression analyses in patient samples, and experimental disease models will be valuable in establishing these connections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.