Recombinant Mouse Solute carrier family 25 member 36 (Slc25a36)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Solute Carrier Family 25 Member 36 (Slc25a36)

Recombinant Mouse Solute Carrier Family 25 Member 36 (Slc25a36) is a protein that belongs to the solute carrier family 25 (SLC25), also known as the mitochondrial carrier family. This family includes proteins responsible for transporting various substrates across the inner mitochondrial membrane, playing crucial roles in mitochondrial function and metabolism. Slc25a36, specifically, has been identified as a mitochondrial transporter involved in the transport of pyrimidine nucleotides, which are essential for mitochondrial DNA and RNA synthesis and breakdown .

Characteristics of Recombinant Mouse Slc25a36

The recombinant full-length mouse Slc25a36 protein is typically expressed in Escherichia coli and is available with an N-terminal His tag for easy purification and identification. The protein consists of 311 amino acids and is provided in a lyophilized powder form. Its purity is greater than 90% as determined by SDS-PAGE .

Characteristics Table

CharacteristicsDescription
SpeciesMus musculus
SourceE. coli
TagHis
Protein LengthFull Length (1-311)
FormLyophilized powder
Purity>90% by SDS-PAGE
Storage-20°C/-80°C

Function and Transport Mechanism

Slc25a36 is known to transport cytosine and uracil (deoxy)nucleoside mono-, di-, and triphosphates across the mitochondrial membrane. This transport is facilitated by both uniport and antiport mechanisms, which are saturable and can be inhibited by mercurial compounds and other mitochondrial carrier inhibitors .

Transport Substrates

  • Cytosine (deoxy)nucleoside mono-, di-, and triphosphates

  • Uracil (deoxy)nucleoside mono-, di-, and triphosphates

Research Findings and Applications

Studies have shown that Slc25a36 plays a crucial role in mitochondrial nucleotide metabolism. The protein is targeted to mitochondria, and its expression can rescue the phenotypic defects in yeast cells lacking the mitochondrial pyrimidine nucleotide carrier RIM2, indicating its functional conservation across species .

Research Implications

  • Mitochondrial DNA and RNA Synthesis: Slc25a36 is essential for providing the necessary nucleotides for mitochondrial DNA and RNA synthesis.

  • Cross-Species Conservation: The ability of Slc25a36 to complement yeast RIM2 defects highlights its conserved function across different organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a36; Solute carrier family 25 member 36
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a36
Target Protein Sequence
MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVV SPGPLHCLKAILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNGVFDPDSTQV HMASAAMAGFTAITATNPIWLIKTRLQLDARTRGEKQMGAFECVRKVYQTDGLRGFYRGM SASYAGISETVIHFVIYESIKQKLLECKTASMMETDEESVKEASDFVRMMLAAATSKTCA TTIAYPHEVVRTRLREEGTKYRSFFQTLSLIVQEEGYGSLYRGLTTHLVRQIPNTAIMMA TYELVVYLLNG
Uniprot No.

Target Background

Function

Recombinant Mouse Solute carrier family 25 member 36 (Slc25a36) is a mitochondrial transporter responsible for the import and export of pyrimidine nucleotides. It preferentially transports cytosine and uracil (deoxy)nucleoside mono-, di-, and triphosphates via uniport and antiport mechanisms. While it also transports guanine nucleotides, it does not transport adenine nucleotides. Its activity is significantly inhibited by pyridoxal 5'-phosphate, 4,7-diphenyl-1,10-phenanthroline, tannic acid, and mercurials (e.g., mercury dichloride, Mersalyl acid, p-hydroxymercuribenzoate). Slc25a36 plays a crucial role in mitochondrial genome maintenance, regulation of mitochondrial membrane potential, and mitochondrial respiration.

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Slc25a36 and what is its main function in mouse cells?

Slc25a36 (solute carrier family 25, member 36) is a mitochondrial carrier protein that functions primarily as a transporter of pyrimidine nucleotides for mitochondrial DNA and RNA synthesis. This protein plays a critical role in regulating mitochondrial function through the transport of cytosine, uracil, and thymine (deoxy)nucleotides across the mitochondrial membrane . It has been identified as a member of the mitochondrial carrier family (MCF) with high sequence homology to SLC25A33, suggesting evolutionary conservation of this important transport mechanism .

Where is Slc25a36 typically expressed in mouse tissues?

Slc25a36 has been found to be highly expressed in naive mouse embryonic stem cells (mESCs) . The expression pattern of this transporter appears to be particularly important in pluripotent cells, where mitochondrial function plays a central role in maintaining the naive state. While the search results don't provide a comprehensive tissue distribution profile, the protein's function in mitochondrial nucleotide transport suggests it may have varying expression levels across tissues with different metabolic demands .

How does Slc25a36 contribute to mitochondrial function?

Slc25a36 contributes to mitochondrial function by facilitating the transport of pyrimidine nucleotides needed for mitochondrial DNA and RNA synthesis . This transport activity is essential for maintaining proper mitochondrial DNA levels and functional integrity. When Slc25a36 is deficient (via knockdown), researchers have observed significant mitochondrial dysfunction characterized by:

  • Decreased mitochondrial DNA content

  • Swollen mitochondrial morphology

  • Reduced mitochondrial membrane potential

  • Lower mitochondrial numbers

  • Downregulation of key transcription regulators involved in mitochondrial biogenesis

What methods can be used to clone and express recombinant Slc25a36 for functional studies?

The recombinant expression of mouse Slc25a36 can be achieved through the following methodology:

  • Amplify the coding sequence of Slc25a36 (accession numbers for human: NM_001104647.1) using PCR from appropriate cDNA libraries (human brain cDNA has been used for the human ortholog) .

  • Design primers with additional restriction enzyme sites as linkers (e.g., BamHI and EcoRI for SLC25A36) .

  • Clone the amplified product into a suitable expression vector (e.g., pMW vector for expression in E. coli) .

  • Transform the construct into a bacterial expression system such as E. coli strain BL21(DE3) .

  • Express the recombinant protein and purify inclusion bodies using a sucrose density gradient .

  • Solubilize the recombinant protein using appropriate detergents (e.g., 1.2% lauric acid diluted with 3% Triton X-114) .

This methodology has been successfully used for the human ortholog and can be adapted for mouse Slc25a36 with appropriate modifications to the primers and expression conditions .

How can researchers effectively measure Slc25a36 transport activity in experimental systems?

Slc25a36 transport activity can be measured using the following reconstitution liposome methodology:

  • Reconstitute the purified recombinant Slc25a36 into liposomes by cyclic removal of detergent with a hydrophobic column of Amberlite beads .

  • Prepare the initial mixture for reconstitution with:

    • Purified protein (~30 μg of SLC25A36)

    • 10% Triton X-114

    • 10% phospholipids (l-α-phosphatidylcholine) in sonicated liposomes

    • 10 mM substrate

    • Cardiolipin (1 mg for SLC25A36)

    • Appropriate buffer (e.g., 5 mM MES-NaOH, 5 mM PIPES-NaOH, pH 6.25 for SLC25A36)

  • Remove external substrate from proteoliposomes using Sephadex G-75 columns pre-equilibrated with appropriate buffer .

  • Start transport measurements by adding labeled substrates to substrate-loaded proteoliposomes (for exchange) or to empty proteoliposomes (for uniport) .

  • Terminate transport using inhibitors such as pyridoxal 5′-phosphate and bathophenanthroline .

  • Remove external radioactivity and measure entrapped radioactivity .

The initial transport rate can be calculated from the radioactivity taken up by proteoliposomes after an appropriate time interval (e.g., 3 min for SLC25A36) in the initial linear range of substrate uptake .

What strategies are most effective for Slc25a36 knockdown studies in mouse embryonic stem cells?

Based on research findings, effective Slc25a36 knockdown studies in mouse embryonic stem cells can be designed using the following approach:

  • Design appropriate siRNA or shRNA targeting conserved regions of the Slc25a36 transcript.

  • Transfect mESCs using appropriate transfection reagents while maintaining stem cell culture conditions.

  • Confirm knockdown efficiency through:

    • qRT-PCR for mRNA expression levels

    • Western blotting for protein expression levels

    • Functional assays to measure mitochondrial parameters

The effectiveness of knockdown should be assessed by monitoring:

  • Changes in mitochondrial DNA content

  • Alterations in mitochondrial membrane potential

  • Modifications in the expression of pluripotency markers (Pou5f1, Sox2, Nanog, and Utf1)

  • Changes in expression of differentiation markers (Cdx2, Gata3, and Hand1)

How does Slc25a36 deficiency affect pluripotency maintenance in mouse embryonic stem cells?

Slc25a36 deficiency has profound effects on pluripotency maintenance in mouse embryonic stem cells through multiple mechanisms:

  • Disruption of pluripotency network: Slc25a36 knockdown results in decreased expression of key pluripotency markers (Pou5f1, Sox2, Nanog, and Utf1), indicating a breakdown of the core transcriptional network that maintains stemness .

  • Induction of differentiation: Simultaneously, the expression of key trophectoderm (TE) genes (Cdx2, Gata3, and Hand1) increases, with Cdx2-positive cells emerging in Slc25a36-deficient colonies under trophoblast stem cell culture conditions .

  • Mitochondrial dysfunction: This occurs through several related mechanisms:

    • Decline in mtDNA levels

    • Swollen mitochondrial morphology

    • Decreased mitochondrial membrane potential

    • Reduced mitochondrial numbers

    • Downregulation of key transcription regulators of mitochondrial biogenesis

  • Metabolic alterations: Slc25a36 deficiency leads to:

    • Downregulated glutathione metabolism, which enhances OCT4 degradation

    • Upregulated focal adhesion, which promotes cell spreading

These combined effects create a coordinated cellular response that reinforces and stabilizes the process of differentiation, demonstrating that Slc25a36-mediated mitochondrial function is integral to maintaining the naive pluripotent state of mESCs .

What is the relationship between Slc25a36 transport activity and mitochondrial DNA maintenance?

Slc25a36 plays a critical role in mitochondrial DNA maintenance through its function as a transporter of pyrimidine nucleotides:

  • Nucleotide supply function: Slc25a36 transports cytosine, uracil, and thymine (deoxy)nucleotides into mitochondria, providing essential building blocks for mtDNA replication and transcription .

  • Evidence from knockdown studies: When Slc25a36 is deficient, mtDNA levels decline significantly, indicating that the nucleotide transport function is essential for maintaining the mitochondrial genome .

  • Functional consequences: The reduction in mtDNA leads to:

    • Compromised mitochondrial structure (swollen morphology)

    • Reduced functional capacity (decreased membrane potential)

    • Diminished mitochondrial biogenesis (lower numbers)

This relationship demonstrates that Slc25a36-mediated nucleotide transport is a prerequisite for proper mtDNA maintenance, which in turn supports mitochondrial function and cellular homeostasis, particularly in cells with high metabolic demands such as embryonic stem cells .

How do Slc25a36 and SLC25A33 functions compare despite their sequence homology?

Despite their high sequence homology, SLC25A33 and SLC25A36 show both similarities and differences in their transport functions:

FeatureSLC25A33SLC25A36
Substrate specificityTransports pyrimidine (deoxy)nucleotidesTransports pyrimidine (deoxy)nucleotides
Transport efficiencyDifferent efficiency for various substratesDifferent efficiency pattern compared to SLC25A33
LocalizationMitochondrialMitochondrial
pH optimumpH 7.0 (10 mM PIPES-NaOH)pH 6.25 (5 mM MES-NaOH, 5 mM PIPES-NaOH)
Exchange rateMeasured after 1.5 minMeasured after 3 min (potentially slower kinetics)

Both carriers are essential for mitochondrial DNA and RNA metabolism, but their distinct kinetic properties and potentially different tissue expression patterns may indicate specialized roles in various cellular contexts . The evolutionary conservation of these two related transporters suggests they may have complementary or partially redundant functions in maintaining mitochondrial nucleotide pools under different physiological conditions .

What techniques are recommended for investigating Slc25a36 subcellular localization?

To investigate the subcellular localization of Slc25a36, researchers can employ the following techniques:

  • Fluorescent protein fusion approach:

    • Create a fusion construct linking Slc25a36 to EGFP (enhanced green fluorescent protein) at the C-terminus

    • Co-transfect cells (e.g., Chinese hamster ovary cells) with this construct and a mitochondrial marker (e.g., mtEBFP - enhanced blue fluorescent protein targeted to mitochondria)

    • Visualize localization using fluorescence microscopy to confirm mitochondrial localization

  • Immunocytochemistry:

    • Use specific antibodies against Slc25a36

    • Co-stain with established mitochondrial markers

    • Visualize using confocal microscopy for high-resolution localization data

  • Subcellular fractionation:

    • Isolate mitochondrial, cytosolic, and other cellular fractions

    • Analyze the presence of Slc25a36 in different fractions by Western blotting

    • Compare with known mitochondrial markers to confirm localization

These complementary approaches can provide robust evidence for the mitochondrial localization of Slc25a36 and potentially reveal any additional subcellular distribution patterns .

What considerations are important when designing experiments to study the impact of Slc25a36 on glutathione metabolism?

When designing experiments to study the impact of Slc25a36 on glutathione metabolism, researchers should consider the following:

  • Measurement techniques:

    • Quantify total glutathione levels using established colorimetric or fluorometric assays

    • Measure the ratio of reduced (GSH) to oxidized (GSSG) glutathione to assess redox state

    • Analyze the expression and activity of key enzymes in glutathione metabolism (glutathione peroxidase, glutathione reductase, etc.)

  • Experimental models:

    • Compare wild-type cells with Slc25a36-deficient cells (knockdown or knockout)

    • Use reconstitution experiments to confirm specificity of observed effects

    • Consider tissue-specific effects, particularly in metabolically active tissues

  • Functional consequences:

    • Investigate the relationship between altered glutathione metabolism and OCT4 degradation

    • Assess oxidative stress markers to determine if mitochondrial dysfunction leads to redox imbalance

    • Examine how changes in glutathione metabolism influence stem cell fate decisions

  • Controls and validation:

    • Include positive controls (known modulators of glutathione metabolism)

    • Validate findings using multiple methodological approaches

    • Consider rescue experiments with glutathione supplementation

These considerations will help establish the mechanistic link between Slc25a36 function, mitochondrial activity, glutathione metabolism, and cellular differentiation observed in embryonic stem cells .

How can researchers effectively measure the impact of Slc25a36 deficiency on mitochondrial membrane potential?

To effectively measure the impact of Slc25a36 deficiency on mitochondrial membrane potential, researchers can employ the following methodological approaches:

  • Fluorescent probes:

    • Use membrane-potential-dependent dyes such as JC-1, TMRM, or TMRE

    • JC-1 provides a ratiometric measurement (red/green fluorescence ratio) that can be quantified by flow cytometry or fluorescence microscopy

    • TMRM/TMRE provide intensity-based measurements that can be more sensitive to subtle changes

  • Experimental design considerations:

    • Include appropriate controls (e.g., CCCP-treated cells as a negative control for membrane potential)

    • Normalize measurements to mitochondrial mass (using dyes like MitoTracker Green)

    • Perform time-course experiments to capture temporal dynamics of membrane potential changes

  • Complementary techniques:

    • Oxygen consumption rate (OCR) measurements to assess mitochondrial respiration

    • ATP production assays to determine functional consequences

    • Electron microscopy to correlate membrane potential changes with structural alterations

  • Data analysis approaches:

    • Quantify the percentage of cells with low membrane potential

    • Measure the mean fluorescence intensity across the population

    • Correlate membrane potential measurements with other parameters (e.g., mtDNA content, expression of pluripotency markers)

These approaches will provide a comprehensive assessment of how Slc25a36 deficiency affects mitochondrial membrane potential, a key indicator of mitochondrial function and cellular health .

What are the most promising approaches for studying the role of Slc25a36 in developmental processes beyond embryonic stem cells?

Investigating the role of Slc25a36 in broader developmental contexts offers several promising research directions:

  • Conditional knockout models:

    • Generate tissue-specific and temporally controlled Slc25a36 knockout mice

    • Analyze developmental phenotypes in various lineages (neural, cardiac, hematopoietic)

    • Examine compensatory mechanisms that may emerge in specific tissues

  • Organoid systems:

    • Utilize 3D organoid cultures derived from Slc25a36-deficient stem cells

    • Assess the impact on organoid formation, maturation, and function

    • Compare effects across different organ systems (brain, liver, intestine)

  • Single-cell approaches:

    • Apply single-cell RNA sequencing to track differentiation trajectories

    • Identify cell populations most sensitive to Slc25a36 deficiency

    • Map the temporal dynamics of mitochondrial dysfunction during development

  • Metabolic profiling:

    • Perform comprehensive metabolomic analysis across developmental stages

    • Trace nucleotide incorporation into mitochondrial DNA/RNA

    • Identify metabolic bottlenecks caused by Slc25a36 deficiency

  • Interspecies comparisons:

    • Examine Slc25a36 function across model organisms (zebrafish, Drosophila)

    • Identify evolutionarily conserved and divergent aspects of its role

    • Use comparative approaches to uncover fundamental principles of mitochondrial-nuclear communication during development

These approaches would expand our understanding of how Slc25a36-mediated mitochondrial function influences developmental processes beyond the pluripotent state, potentially revealing stage-specific and tissue-specific requirements for this transporter.

What are the most common challenges in achieving efficient expression of recombinant Slc25a36 and how can they be addressed?

Researchers working with recombinant Slc25a36 may encounter several challenges that can be addressed through specific troubleshooting approaches:

  • Protein solubility issues:

    • Challenge: Membrane proteins like Slc25a36 often form inclusion bodies in bacterial expression systems

    • Solution: Optimize solubilization conditions by testing different detergents (e.g., 1.2% lauric acid with 3% Triton X-114) and include additives like 20 mM Na₂SO₄ if needed

    • Alternative approach: Consider using eukaryotic expression systems for better folding

  • Low expression levels:

    • Challenge: Mitochondrial carriers may express poorly in heterologous systems

    • Solution: Optimize codon usage for the expression host, reduce expression temperature, use specialized E. coli strains (e.g., BL21(DE3)), and test different induction conditions

    • Alternative: Use fusion tags (His-tag, GST) to improve expression and facilitate purification

  • Functional reconstitution difficulties:

    • Challenge: Maintaining transport activity during purification and reconstitution

    • Solution: Carefully control detergent removal rate during liposome reconstitution, optimize lipid composition by including cardiolipin, and ensure appropriate pH conditions (e.g., pH 6.25 for SLC25A36)

    • Validation: Include functional controls to verify transport activity after reconstitution

  • Protein stability concerns:

    • Challenge: Recombinant Slc25a36 may be unstable during purification and storage

    • Solution: Add stabilizing agents, work at 4°C throughout purification, avoid freeze-thaw cycles, and optimize buffer conditions

    • Storage: Determine optimal storage conditions (glycerol percentage, temperature, additives)

By addressing these common challenges using the suggested approaches, researchers can improve the yield and quality of recombinant Slc25a36 for functional and structural studies .

What control experiments are essential when investigating the effects of Slc25a36 on mitochondrial function?

When investigating the effects of Slc25a36 on mitochondrial function, the following control experiments are essential:

  • Knockdown/knockout validation controls:

    • Quantify Slc25a36 mRNA levels using qRT-PCR

    • Confirm protein reduction via Western blot

    • Include non-targeting siRNA/shRNA controls to account for non-specific effects

  • Rescue experiments:

    • Re-express wild-type Slc25a36 in knockdown/knockout cells

    • Use point mutants to identify critical residues for function

    • Consider expressing the homologous SLC25A33 to assess functional redundancy

  • Mitochondrial function controls:

    • Include positive controls for mitochondrial dysfunction (e.g., CCCP, ethidium bromide)

    • Measure multiple parameters (membrane potential, mtDNA content, morphology)

    • Normalize mitochondrial function parameters to mitochondrial mass

  • Specificity controls:

    • Test effects on other cellular compartments to confirm mitochondrial specificity

    • Examine other SLC25 family members to rule out compensatory mechanisms

    • Assess global cellular parameters (viability, proliferation, ATP levels)

  • Temporal controls:

    • Perform time-course experiments to distinguish primary from secondary effects

    • Use inducible systems to control the timing of Slc25a36 depletion

    • Monitor acute versus chronic responses to differentiate adaptation from direct effects

These control experiments will ensure that the observed effects on mitochondrial function are specifically attributable to Slc25a36 deficiency rather than experimental artifacts or secondary consequences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.