Recombinant Mouse Solute carrier family 25 member 41 (Slc25a41)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment based on availability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for prioritized development.
Synonyms
Slc25a41; SCaMC3L; Calcium-independent mitochondrial carrier protein SCaMC-3L; Mitochondrial ATP-Mg/Pi carrier protein SLC25A41; Small calcium-binding mitochondrial carrier protein 3-like; SCaMC-3-like; SCaMC-3L; Solute carrier family 25 member 41
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a41
Target Protein Sequence
MGVHLEVLDTGEQLMVPVDVLEEENKGTLWKFLLSGAMAGAVSRTGTAPLDRARVYMQVY SSKSNFRNLLSGLRSLVQEGGVRSLWRGNGINVLKIAPEYAIKFSVCEQSKNFFYGVHSS QLFQERVVAGSLAVAVSQTLINPMEVLKTRLTLRFTGQYKGLLDCARQILERDGTRALYR GYLPNMLGIIPYACTDLAVYELLQCLWQKLGRDMKDPSGLVSLSSVTLSTTCGQMASYPL TLVRTRMQAQDTVEGSNPTMQGVFKRILSQQGWPGLYRGMTPTLLKVLPAGGISYLVYEA MKKTLGVQVLSR
Uniprot No.

Target Background

Function
Recombinant Mouse Solute Carrier Family 25 Member 41 (Slc25a41) is a calcium-independent ATP-Mg/Pi exchanger. It catalyzes the electroneutral exchange of Mg-ATP or free ADP for hydrogenphosphate, participating in the net transport of adenine nucleotides across the mitochondrial inner membrane.
Gene References Into Functions
  1. Mouse SCaMC-3L exhibits limited expression, primarily in the testis and, to a lesser extent, the brain. (PMID: 18928449)
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly expressed in testis and at lesser levels in brain.

Q&A

How does recombinant mouse Slc25a41 differ from native protein?

Recombinant mouse Slc25a41 is typically expressed with fusion tags (such as His tag or Strep tag) to facilitate purification and detection. The most common expression system for research-grade recombinant mouse Slc25a41 is HEK-293 cells, which provides mammalian post-translational modifications .

Key differences include:

FeatureNative Mouse Slc25a41Recombinant Mouse Slc25a41
Expression systemMouse tissuesHEK-293 cells or cell-free systems
Fusion tagsNoneUsually His tag or Strep tag
PurityMixed with other proteins>90% when expressed in HEK-293 cells; 70-80% in cell-free systems
Post-translational modificationsNatural mouse modificationsHuman cell line modifications (HEK-293) or minimal (cell-free)
ApplicationsNatural function in vivoIn vitro studies, antibody production, functional assays

These differences should be considered when designing experiments, as the tag may influence protein folding, activity, or interaction with other molecules .

What are the optimal storage conditions for recombinant mouse Slc25a41?

For optimal stability and activity retention of recombinant mouse Slc25a41, the following storage conditions are recommended:

  • Temperature: Store at -80°C for long-term preservation

  • Buffer composition: The specific buffer depends on the manufacturer but should maintain protein stability

  • Avoid repeated freeze-thaw cycles as these can dramatically reduce protein activity

  • Expected shelf life: Approximately 12 months when stored properly at -80°C

  • For working solutions, store aliquots to minimize freeze-thaw damage

When designing experiments, it's advisable to thaw the protein on ice and use it immediately for optimal activity. Mitochondrial carrier proteins like Slc25a41 contain hydrophobic transmembrane domains that can make them susceptible to aggregation if improperly handled .

What are the most effective expression systems for producing functional recombinant mouse Slc25a41?

The choice of expression system significantly impacts the functionality of recombinant mouse Slc25a41. Based on research data, the following systems have demonstrated success:

Expression SystemProtein PurityFunctionalityAdvantagesLimitations
HEK-293 cells>90%HighMammalian post-translational modifications; proper foldingTime-consuming; higher cost
Cell-free protein synthesis (CFPS)70-80%ModerateRapid production; absence of cellular contaminantsLimited post-translational modifications
Bacterial systems (E. coli)VariableLowerCost-effective; high yieldPoor solubility; inclusion bodies common; lack of PTMs

HEK-293 cells are generally the preferred expression system for functional studies of mouse Slc25a41, as evidenced by higher purity (>90% as determined by Bis-Tris PAGE, anti-tag ELISA, Western Blot, and analytical SEC) .

For experimental approaches requiring significant structural and functional integrity, mammalian expression systems are recommended. Bacterial expression may be suitable for applications like antibody production but often requires optimization of solubilization and refolding protocols for membrane proteins like Slc25a41 .

How can researchers validate the functionality of recombinant mouse Slc25a41 in vitro?

Validating the functionality of recombinant mouse Slc25a41 requires assessing its ATP-Mg/Pi exchange activity. The following methodological approaches are recommended:

  • Reconstitution into liposomes:

    • Prepare liposomes using a mixture of phospholipids (typically phosphatidylcholine and phosphatidylethanolamine)

    • Incorporate purified Slc25a41 into liposomes using detergent removal methods

    • Measure substrate transport across the liposomal membrane

  • ATP exchange assay:

    • Load liposomes with radiolabeled substrates (e.g., [³²P]Pi)

    • Measure the efflux/uptake of labeled substrates over time

    • Calculate transport rates and kinetic parameters (Km, Vmax)

  • Mitochondrial incorporation:

    • Isolate mitochondria from Slc25a41-deficient cells

    • Reintroduce recombinant Slc25a41

    • Measure restoration of ATP transport function

These functional assays should be complemented with structural validation by circular dichroism or thermal shift assays to confirm proper protein folding .

What are the critical considerations when designing antibodies against mouse Slc25a41?

Designing effective antibodies against mouse Slc25a41 requires careful epitope selection and validation strategies:

  • Epitope selection considerations:

    • Avoid transmembrane domains (hydrophobic regions), which are often poorly immunogenic and inaccessible

    • Target hydrophilic loops exposed to the intermembrane space or matrix

    • Consider species conservation if cross-reactivity is desired

    • Analyze potential post-translational modification sites that might affect antibody recognition

  • Validation approaches:

    • Western blotting against both recombinant protein and endogenous Slc25a41 from mitochondrial fractions

    • Immunoprecipitation followed by mass spectrometry

    • Immunohistochemistry with appropriate controls (knockout tissue ideal)

    • Competition assays with the immunizing peptide

  • Application-specific optimization:

    • For immunohistochemistry: Optimize fixation methods to preserve mitochondrial structure

    • For flow cytometry: Ensure proper permeabilization to access mitochondrial proteins

    • For proximity ligation assays: Validate antibody pairs for non-overlapping epitopes

When validating antibodies, researchers should follow standardized reporting guidelines to ensure reproducibility in the scientific community .

How does Slc25a41 expression and function compare with other SLC25 family members in mitochondrial transport studies?

The SLC25 family comprises 53 members with diverse substrate specificities and tissue distributions. Comparing Slc25a41 with other family members reveals important functional distinctions:

SLC25 MemberPrimary SubstratesTransport MechanismTissue ExpressionDisease Associations
SLC25A41ATP-Mg/PiExchangerBroad distributionLimited data
SLC25A33Pyrimidine nucleotidesAntiportHighly expressed in tissues with active mtDNA replicationmtDNA depletion upon knockdown
SLC25A36Pyrimidine nucleotidesUniport and antiportSimilar to SLC25A33Limited data
SLC25A4 (ANT1)ADP/ATPStrict exchangeHigh in heart, skeletal muscleMitochondrial myopathy
SLC25A7 (UCP1)H+ (protons)Proton leakBrown adipose tissueThermogenesis-related

Unlike SLC25A33 and SLC25A36 which transport pyrimidine nucleotides, Slc25a41 specializes in ATP-Mg/Pi exchange. This functional diversity reflects the evolutionary adaptation of the SLC25 family to meet various metabolic needs.

When designing experiments to study mitochondrial transport, researchers should consider that many SLC25 transporters have overlapping substrate specificities but different kinetic properties and regulatory mechanisms .

What are the implications of Slc25a41 in mitochondrial disease models and potential therapeutic targets?

While specific disease associations for Slc25a41 are still emerging, research on related SLC25 family members provides insight into potential roles in pathology:

  • Mitochondrial energy metabolism:

    • As an ATP-Mg/Pi exchanger, Slc25a41 likely influences ATP availability in the mitochondrial matrix

    • Dysregulation could potentially impact oxidative phosphorylation efficiency

    • Mouse models with altered Slc25a41 expression may exhibit metabolic phenotypes

  • Cancer metabolism:

    • Several SLC25 family members show altered expression in various cancers

    • Metabolic reprogramming in cancer often involves mitochondrial transport alterations

    • Studies have used techniques like qPCR and immunohistochemistry to validate SLC25 expression changes in cancer tissues

  • Experimental approaches for therapeutic targeting:

    • Small molecule modulators of transport activity

    • Gene therapy approaches for correction of expression defects

    • Metabolic bypass strategies to compensate for transport deficiencies

When investigating Slc25a41 in disease contexts, researchers should employ comprehensive approaches including tissue-specific knockout models, metabolomics profiling, and cellular bioenergetics measurements .

What methodological challenges exist in studying the structure-function relationship of recombinant mouse Slc25a41?

Investigating structure-function relationships of Slc25a41 presents several technical challenges:

  • Structural characterization challenges:

    • Membrane proteins like Slc25a41 are difficult to crystallize for X-ray crystallography

    • Transmembrane domains create challenges for solution NMR studies

    • Cryo-EM approaches may require stable detergent micelles or nanodiscs

    • Computational modeling based on homology with other SLC25 family members can provide predictive structures

  • Functional characterization challenges:

    • Discriminating Slc25a41 activity from other mitochondrial carriers in cellular systems

    • Developing robust in vitro transport assays with appropriate sensitivity

    • Determining physiologically relevant substrates and conditions

  • Experimental approaches to overcome challenges:

    • Site-directed mutagenesis of conserved residues to assess functional importance

    • Chimeric proteins combining domains from different SLC25 members

    • Reconstitution into defined liposome systems for isolated functional studies

    • Mass spectrometry approaches for identifying interaction partners

Researchers should consider employing complementary approaches, including both in vitro reconstitution systems and cellular models, to comprehensively understand Slc25a41 structure-function relationships .

How can researchers effectively distinguish Slc25a41 function from other mitochondrial carriers in complex biological systems?

Differentiating Slc25a41 function from other mitochondrial carriers requires targeted experimental approaches:

  • Genetic manipulation strategies:

    • CRISPR/Cas9-mediated knockout of Slc25a41 in cell lines or animal models

    • Rescue experiments with wild-type or mutant Slc25a41 to establish specificity

    • Conditional knockout systems to study tissue-specific effects

  • Biochemical approaches:

    • Substrate specificity profiling using reconstituted systems

    • Inhibitor screens to identify Slc25a41-specific modulators

    • Metabolic flux analysis comparing wild-type and Slc25a41-deficient systems

  • Analytical techniques:

    • Targeted metabolomics to measure changes in substrate concentrations

    • Mitochondrial respiration analysis using Seahorse or similar platforms

    • Membrane potential measurements to assess bioenergetic consequences

  • Validation strategies:

    • qPCR verification of knockdown/knockout efficiency

    • Western blotting to confirm protein absence/presence

    • Immunohistochemistry to assess tissue-specific expression patterns

These approaches should be combined in a systematic workflow to establish specific contributions of Slc25a41 to mitochondrial function and cellular metabolism .

What are the optimal approaches for studying Slc25a41 interactions with other mitochondrial proteins?

Investigating Slc25a41 protein-protein interactions requires specialized techniques for membrane proteins:

  • Affinity-based methods:

    • Co-immunoprecipitation with specific antibodies against Slc25a41

    • Pull-down assays using tagged recombinant Slc25a41

    • BioID or APEX2 proximity labeling to identify proteins in the vicinity of Slc25a41

  • Biophysical interaction studies:

    • Förster resonance energy transfer (FRET) between labeled proteins

    • Surface plasmon resonance (SPR) with immobilized Slc25a41

    • Isothermal titration calorimetry (ITC) for quantitative binding parameters

  • In situ visualization:

    • Proximity ligation assay (PLA) to detect protein interactions in fixed cells

    • Super-resolution microscopy to observe co-localization at nanoscale resolution

    • Split-GFP complementation to validate direct interactions

  • Computational approaches:

    • Molecular docking to predict binding interfaces

    • Coevolution analysis to identify potentially interacting residues

    • Network analysis of mitochondrial interactome data

When reporting interaction data, researchers should clearly describe the detergent or membrane mimetic environment used, as these can significantly influence observed interactions with membrane proteins like Slc25a41 .

How can researchers address data inconsistencies when characterizing recombinant mouse Slc25a41?

Researchers frequently encounter inconsistencies when working with recombinant proteins like Slc25a41. A systematic troubleshooting approach includes:

  • Expression system variables:

    • Evaluate protein quality from different expression systems (HEK-293 vs. cell-free)

    • Assess impact of fusion tags on protein folding and activity

    • Consider codon optimization for the expression system used

  • Protein quality control measures:

    • Employ multiple validation methods (SEC-HPLC, SDS-PAGE, Western blot)

    • Test protein stability under experimental conditions

    • Validate proper folding using circular dichroism or thermal shift assays

  • Functional assay standardization:

    • Establish positive and negative controls for transport assays

    • Determine the linear range and detection limits of assays

    • Account for background transport in liposome systems

  • Data reporting and analysis:

    • Document complete experimental conditions, including buffer composition

    • Apply appropriate statistical tests for significance

    • Consider biological vs. technical replicates in experimental design

  • Reconciliation approaches for conflicting data:

    • Systematic comparison of methodological differences

    • Meta-analysis of multiple datasets

    • Independent validation by different laboratories

Researchers should maintain detailed records of all variables that could affect protein quality and performance to facilitate troubleshooting of inconsistent results .

How might single-cell approaches enhance our understanding of Slc25a41 function in heterogeneous tissues?

Single-cell technologies offer new opportunities to investigate Slc25a41 function in complex tissue environments:

  • Single-cell transcriptomics applications:

    • Identify cell populations with high Slc25a41 expression

    • Correlate Slc25a41 expression with mitochondrial gene expression programs

    • Discover cell type-specific co-expression patterns with other transporters

  • Spatial transcriptomics approaches:

    • Map Slc25a41 expression patterns within tissue architecture

    • Correlate expression with microenvironmental features

    • Identify regional variations in mitochondrial transporter expression

  • Single-cell proteomics considerations:

    • Challenges in detecting low-abundance membrane proteins like Slc25a41

    • Targeted approaches using antibody-based methods

    • Correlation with mitochondrial protein markers

  • Functional single-cell approaches:

    • Mitochondrial activity measurements in defined cell populations

    • CRISPR screening in heterogeneous populations

    • Cell-specific metabolic profiling

These emerging technologies can reveal previously unrecognized heterogeneity in Slc25a41 expression and function across different cell types within tissues, potentially identifying specialized roles in particular cellular contexts .

What roles might Slc25a41 play in mitochondrial dynamics and quality control pathways?

Beyond its transport function, Slc25a41 may influence broader aspects of mitochondrial biology:

  • Potential roles in mitochondrial dynamics:

    • Impact on mitochondrial membrane potential affecting fusion/fission balance

    • Influence on cristae structure through nucleotide distribution

    • Potential interactions with proteins involved in mitochondrial morphology

  • Connections to mitochondrial quality control:

    • Effects on mitophagy through energetic status regulation

    • Potential role in mtDNA maintenance via nucleotide transport

    • Involvement in proteostasis through energy-dependent protein degradation

  • Experimental approaches to investigate these connections:

    • Live-cell imaging of mitochondrial dynamics in Slc25a41-deficient models

    • Assessment of mitochondrial turnover rates

    • Measurements of mitochondrial proteome stability

    • Analysis of mtDNA copy number and integrity

The broader role of Slc25a41 in mitochondrial homeostasis represents an important frontier in understanding how metabolite transport interfaces with organelle maintenance and quality control mechanisms .

How can systems biology approaches integrate Slc25a41 function into broader metabolic networks?

Systems biology offers powerful frameworks to contextualize Slc25a41 function within cellular metabolism:

  • Metabolic modeling approaches:

    • Constraint-based modeling incorporating Slc25a41 transport kinetics

    • Flux balance analysis to predict metabolic consequences of altered transport

    • Multi-scale models connecting mitochondrial and cellular metabolism

  • Network analysis methods:

    • Integration of Slc25a41 into mitochondrial protein interaction networks

    • Correlation network analysis across diverse tissues and conditions

    • Identification of metabolic modules dependent on Slc25a41 function

  • Multi-omics integration strategies:

    • Combined analysis of transcriptomics, proteomics, and metabolomics data

    • Temporal dynamics of metabolic adaptation to Slc25a41 perturbation

    • Tissue-specific metabolic signatures associated with varying Slc25a41 expression

  • Computational predictions and validation:

    • In silico prediction of Slc25a41 impact on metabolic fluxes

    • Experimental validation using isotope tracing methods

    • Iterative refinement of models based on experimental findings

These integrative approaches can reveal emergent properties and system-level effects of Slc25a41 function that may not be apparent from reductionist studies, potentially identifying novel therapeutic targets or biomarkers related to mitochondrial transport defects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.