Recombinant Mouse Solute carrier family 25 member 42 (Slc25a42)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Slc25a42 belongs to the SLC25 family of mitochondrial carrier proteins, which facilitate the transport of nucleotides, cofactors, and metabolites. The mouse ortholog shares 83% amino acid sequence identity with human SLC25A42 , underscoring its evolutionary conservation. Recombinant Slc25a42 is produced in Escherichia coli (E. coli) with an N-terminal His tag for purification .

Substrate Specificity

Slc25a42 functions as a counter-exchange transporter for:

  • Coenzyme A (CoA)

  • Dephospho-CoA

  • Adenosine 3',5'-diphosphate (PAP)

  • Adenine nucleotides (ADP/ATP)

Its substrate-binding site shares structural similarities with ADP/ATP carriers, enabling high-affinity interactions with phosphorylated molecules .

Inhibition Profile

Transport activity is partially inhibited by:

  • Bongkrekic acid (51% inhibition)

  • Pyridoxal-5′-phosphate

  • Tannic acid

Functional Studies

Recombinant Slc25a42 is used to:

  • Investigate mitochondrial CoA transport mechanisms .

  • Model human SLC25A42-associated diseases (e.g., mitochondrial encephalomyopathy) .

  • Study metabolic reprogramming in placental insufficiency .

Disease Modeling

Knockdown of Slc25a42 in zebrafish causes:

  • Dorsal curvature and motor defects .

  • Delayed hatching due to energy metabolism disruption .

Ortholog Comparison

SpeciesSequence IdentityKey Functional Role
Human83% CoA/PAP transport; linked to encephalomyopathy
Rat83% Underexplored; presumed similar to mouse
Zebrafish~70% (estimated)Embryonic development and motility

Recommended Experimental Use

  • Blocking experiments: Pre-incubate antibodies with a 100x molar excess of recombinant protein .

  • Western blot/IHC: Use at 0.1–1.0 mg/mL concentration .

Future Directions

  • Elucidate structural dynamics via cryo-EM.

  • Develop targeted therapies for SLC25A42-related mitochondrial disorders .

  • Explore roles in fetal metabolic reprogramming .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a42; Mitochondrial coenzyme A transporter SLC25A42; Solute carrier family 25 member 42
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a42
Target Protein Sequence
MGNGVQEGSVRLREDAEAVLAGAVSSKRDHRQVLSSLLSGALAGALAKTAVAPLDRTKII FQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGH YYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISRE EGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIG QSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVG ISFTTFDLMQILLRRLQS
Uniprot No.

Target Background

Function
Mitochondrial carrier facilitating the exchange of coenzyme A (CoA) for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of mouse Slc25a42 in mitochondrial metabolism?

Mouse Slc25a42, similar to its human ortholog, functions as a mitochondrial transporter localized at the inner mitochondrial membrane. It plays a crucial role in cellular energy metabolism by facilitating the transport of coenzyme A (CoA) and adenosine 3′,5′-diphosphate (PAP) across the inner mitochondrial membrane. The protein primarily catalyzes a counter-exchange transport mechanism, importing CoA into mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3′,5′-diphosphate .

This transport function is essential for maintaining appropriate CoA levels within the mitochondrial matrix, where CoA serves as a critical cofactor for numerous metabolic processes. CoA is required for the tricarboxylic acid (TCA) cycle, fatty acid β-oxidation, and amino acid metabolism. Studies have demonstrated that SLC25A42 exhibits high transport affinity for CoA, dephospho-CoA, ADP, and adenosine 3′,5′-diphosphate . The transport mechanism is specifically characterized as a counter-exchange, meaning that the import of one substrate is coupled to the export of another.

Deficiency of SLC25A42 leads to reduced intracellular CoA levels and impaired mitochondrial function, which can manifest as decreased oxygen consumption rates in tissues with high energy demands such as muscle and brain . This underscores the protein's essential role in energy metabolism and CoA homeostasis across cellular compartments.

How does Slc25a42 structure relate to its transport function?

The structure of Slc25a42, like other members of the mitochondrial carrier family (SLC25), features characteristic elements that facilitate its transport function. The protein contains six transmembrane helices arranged in three repeats, with each repeat consisting of two transmembrane α-helices. This structural arrangement creates a "single binding center-gating pore" transport mechanism that is fundamental to its function .

The conformational changes that enable substrate transport involve two distinct states: the c-state (cytoplasmic-open state) and the m-state (matrix-open state). In the c-state, the matrix gate is formed by three initial stretches of the signature motif sequence (SMS) PX[DE]XX[KR], where prolines kink helices H1, H3, and H5, and the charged residues participate in salt-bridges interconnecting these three helices . In the m-state, this salt-bridge relay is broken, and a similar salt-bridge network forms at the c-gate residues [DE]XX[KR] located near the intermembrane space on helices H2, H4, and H6 .

The central substrate binding site is determined by residues of helices H2, H4, and H6 located at positions called contact points I, II, and III, respectively, positioned approximately at the same level in the middle of the membrane . This binding site has high specificity for CoA and related molecules, which explains the transporter's substrate preference.

Inhibition studies with bongkrekic acid and other inhibitors of mitochondrial carriers have provided additional insights into the structural aspects of transport, as these inhibitors compete with transported substrates at the binding site . Understanding these structural features is essential for investigating how mutations might affect transport function and lead to disease states.

What expression systems are recommended for producing recombinant mouse Slc25a42?

Several expression systems have been successfully employed for producing recombinant mitochondrial carriers, including SLC25A42. Based on published methodologies, the following expression systems are recommended for mouse Slc25a42:

  • Bacterial Expression in E. coli: This is particularly useful for biochemical and structural studies requiring large protein quantities. The human SLC25A42 has been successfully expressed in E. coli using the pMW7 expression vector . For mouse Slc25a42, similar approaches can be adopted, with the coding sequence amplified by PCR and cloned into appropriate expression vectors using restriction sites such as NdeI and EcoRI . E. coli strains like BL21(DE3) are typically preferred for expression of mitochondrial carriers.

  • Yeast Expression Systems: Saccharomyces cerevisiae offers advantages for expressing eukaryotic membrane proteins. The pYES2 expression vector under the control of the GAL10 promoter or the constitutive MIR1 promoter has been successfully used for human SLC25A42 . This system may provide proper folding and post-translational modifications that are closer to native conditions compared to bacterial systems.

  • Mammalian Cell Expression: For studies investigating subcellular localization or requiring mammalian post-translational modifications, CHO cells have been effectively used. For localization studies, C-terminal fusion with EGFP can be achieved by amplifying the coding sequence without the termination codon and cloning it into modified vectors such as pcDNA3 . This approach allows visualization of the protein's mitochondrial targeting in living cells.

When selecting an expression system, researchers should consider their experimental objectives, required protein yield, downstream applications, and the importance of post-translational modifications. For functional reconstitution studies, the bacterial system has proven effective for producing sufficient quantities of functional protein that can be reconstituted into liposomes .

How can researchers confirm the mitochondrial localization of recombinant mouse Slc25a42?

Confirming the mitochondrial localization of recombinant mouse Slc25a42 is essential for validating its proper expression and cellular targeting. Several complementary approaches can be employed:

  • Fluorescent Protein Fusion: Fusing Slc25a42 with fluorescent proteins like EGFP allows for direct visualization in living cells. The C-terminus is typically preferred for fusion to avoid interfering with the N-terminal mitochondrial targeting sequence. As demonstrated with human SLC25A42, researchers can co-transfect cells with mtEBFP (a blue fluorescent protein with mitochondrial targeting) and the Slc25a42-EGFP fusion construct to assess colocalization . Overlapping signals confirm mitochondrial localization.

  • Immunofluorescence Microscopy: Using antibodies specific to Slc25a42 or to epitope tags (HA, FLAG, etc.) incorporated into the recombinant protein, combined with mitochondrial markers such as MitoTracker or antibodies against known mitochondrial proteins (e.g., TOMM20, COX IV), allows visualization of colocalization through confocal microscopy.

  • Subcellular Fractionation: Biochemical isolation of mitochondria followed by Western blotting can provide quantitative evidence of mitochondrial localization. This approach involves:

    • Differential centrifugation to separate cellular compartments

    • Isolation of a crude mitochondrial fraction

    • Further purification using density gradient centrifugation

    • Western blot analysis comparing the distribution of Slc25a42 with markers for different cellular compartments

  • Protease Protection Assay: This technique can determine the orientation of the protein in the mitochondrial membrane by treating isolated mitochondria with proteases before and after membrane permeabilization, followed by Western blot analysis to detect protected fragments.

These methods should be used in combination to provide robust evidence of proper mitochondrial localization. Additionally, functional assays measuring transport activity in isolated mitochondria can provide further confirmation that the protein is not only localized to mitochondria but also correctly inserted and functional in the inner mitochondrial membrane.

What are the optimal conditions for purifying and reconstituting mouse Slc25a42 for transport assays?

Purification and reconstitution of mouse Slc25a42 for functional transport assays requires careful optimization. Based on successful protocols used for human SLC25A42 and other mitochondrial carriers, the following methodology is recommended:

Protein Purification:

  • Expression in E. coli and Inclusion Body Isolation:

    • After expression in E. coli, harvest cells by centrifugation.

    • Resuspend bacterial pellets in buffer (typically 10 mM Tris-HCl, pH 8.0) containing protease inhibitors.

    • Disrupt cells by sonication or using a French press.

    • Collect inclusion bodies by centrifugation at high speed (approximately 18,000 × g) .

  • Solubilization:

    • Solubilize inclusion bodies using 1.7% sarkosyl (N-lauroylsarcosine) in 10 mM Tris-HCl (pH 8.0).

    • Remove insoluble material by centrifugation .

Reconstitution into Liposomes:

  • Preparation of Proteoliposomes:

    • Dilute the sarkosyl-solubilized protein 11-fold with buffer containing 10 mM Tris-HCl (pH 8.0) and 0.6% Triton X-114.

    • Prepare a reconstitution mixture containing:

      • Purified Slc25a42 protein (approximately 15 μg)

      • 10% Triton X-114 (70 μl)

      • 10% phospholipids in the form of sonicated liposomes (90 μl)

      • Internal substrate (e.g., 10 mM ADP) for counter-exchange

      • 10 mM Tris-HCl (pH 8.0)

      • Cardiolipin (0.6 mg) .

  • Detergent Removal:

    • Remove detergent by cyclic application to an Amberlite column (3.5 × 0.5 cm) pre-equilibrated with buffer containing the same concentration of substrate as in the starting mixture.

    • Typically, 13 cycles through the column are sufficient for complete detergent removal .

  • Liposome Recovery:

    • External substrate can be removed by passing proteoliposomes through Sephadex G-75 columns.

    • Proteoliposomes are usually resuspended in buffer containing 10 mM Tris-HCl (pH 8.0).

This methodology has been successfully applied to human SLC25A42 and should be adaptable to mouse Slc25a42 with minimal modifications. Critical factors for success include maintaining protein stability during solubilization, ensuring complete detergent removal, and creating liposomes with appropriate lipid composition including cardiolipin, which is important for the function of many mitochondrial carriers.

How can the transport kinetics of mouse Slc25a42 be accurately measured and analyzed?

Measuring and analyzing the transport kinetics of mouse Slc25a42 requires careful experimental design and rigorous data analysis. The following methodology provides a comprehensive approach:

Transport Assay Setup:

  • Preparation of Substrate-Loaded Liposomes:

    • Reconstitute purified Slc25a42 into liposomes preloaded with an exchange substrate (typically 10 mM ADP or other nucleotides) .

    • Remove external substrate using gel filtration chromatography.

  • Initiation of Transport:

    • Start the transport reaction by adding radiolabeled substrates (e.g., [14C]CoA, [3H]ADP) to the proteoliposomes.

    • Incubate at a controlled temperature (typically 25°C).

  • Termination and Measurement:

    • Stop the reaction at various time points by adding specific inhibitors (e.g., bongkrekic acid) or by rapid filtration.

    • For filtration, use cellulose acetate/nitrate filters with pore size 0.22 μm.

    • Wash filters with buffer to remove non-specific binding.

    • Measure radioactivity by liquid scintillation counting .

Kinetic Analysis:

  • Initial Rate Determination:

    • Measure transport over a short time course (e.g., 5, 15, 30, 60 seconds) to determine initial rates.

    • Plot uptake versus time and calculate the slope of the linear portion of the curve.

  • Determination of Km and Vmax:

    • Perform transport assays with varying substrate concentrations.

    • Plot initial transport rates against substrate concentration.

    • Fit the data to the Michaelis-Menten equation using non-linear regression:
      v=Vmax×[S]Km+[S]v = \frac{V_{max} \times [S]}{K_m + [S]}

    • Extract Km (substrate concentration at half-maximal transport rate) and Vmax (maximal transport rate).

  • Inhibition Studies:

    • To characterize inhibitors, preincubate proteoliposomes with varying concentrations of inhibitor.

    • Determine IC50 values by plotting percent inhibition versus inhibitor concentration.

    • For competitive inhibitors, calculate Ki values using the Cheng-Prusoff equation:
      Ki=IC501+[S]KmK_i = \frac{IC_{50}}{1 + \frac{[S]}{K_m}}

Based on studies of human SLC25A42, mouse Slc25a42 is expected to exhibit high transport affinity for CoA, dephospho-CoA, ADP, and adenosine 3′,5′-diphosphate . The transport is likely to be inhibited by bongkrekic acid and other inhibitors of mitochondrial carriers to varying degrees . Careful characterization of these kinetic parameters provides valuable insights into the molecular mechanism of transport and allows comparison with other mitochondrial carriers or with mutant variants.

What mutagenesis strategies can identify key functional residues in mouse Slc25a42?

Identifying key functional residues in mouse Slc25a42 requires systematic mutagenesis strategies targeted at domains and residues predicted to be involved in substrate binding, gating, or conformational changes. The following approaches are recommended:

Site-Directed Mutagenesis of Predicted Functional Domains:

  • Substrate Binding Site Residues:

    • Target residues in helices H2, H4, and H6 at positions corresponding to contact points I, II, and III, which are predicted to form the substrate binding site .

    • Create conservative substitutions (e.g., Lys→Arg, Asp→Glu) and non-conservative substitutions (e.g., charged→neutral, polar→nonpolar) to assess the importance of specific physicochemical properties.

  • Matrix and Cytosolic Gate Residues:

    • Mutate residues in the PX[DE]XX[KR] motifs on helices H1, H3, and H5 that form the matrix gate .

    • Target the [DE]XX[KR] residues on helices H2, H4, and H6 that form the cytosolic gate .

    • Focus on charged residues involved in salt-bridge formation, which are critical for the alternating access mechanism.

  • Transmembrane Proline Residues:

    • Mutate the conserved proline residues that introduce kinks in transmembrane helices, which are important for conformational changes during transport .

Experimental Approach:

  • Generation of Mutant Constructs:

    • Use PCR-based site-directed mutagenesis to introduce specific mutations into the Slc25a42 coding sequence.

    • Verify mutations by DNA sequencing.

  • Functional Characterization:

    • Express wild-type and mutant proteins in parallel under identical conditions.

    • Purify and reconstitute proteins into liposomes following standardized protocols.

    • Measure transport activity using radiolabeled substrates.

    • Compare kinetic parameters (Km, Vmax) between wild-type and mutant proteins.

  • Substrate Specificity Analysis:

    • Test mutants with different substrates to identify residues that contribute to substrate specificity.

    • Measure competition between substrates to assess changes in binding preferences.

  • Inhibitor Sensitivity:

    • Evaluate sensitivity to inhibitors such as bongkrekic acid, which can provide insights into conformational states .

Advanced Analytical Methods:

  • Thermal Stability Assays:

    • Use differential scanning fluorimetry or thermal denaturation assays to assess the impact of mutations on protein stability.

    • Compare thermal stability in the presence and absence of substrates to evaluate substrate binding.

  • Cysteine Scanning Mutagenesis:

    • Systematically replace residues with cysteine and use thiol-specific reagents to probe accessibility.

    • This approach can map the substrate translocation pathway and identify conformationally sensitive regions.

  • Molecular Dynamics Simulations:

    • Complement experimental data with computational modeling to predict the effects of mutations on protein dynamics and substrate interactions.

This systematic mutagenesis approach will generate a comprehensive map of functionally important residues in mouse Slc25a42, providing insights into its transport mechanism and substrate specificity. The findings can be correlated with known disease-causing mutations in human SLC25A42 to understand the molecular basis of pathogenicity.

How does Slc25a42 deficiency impact mitochondrial energy metabolism in mouse models?

Slc25a42 deficiency profoundly impacts mitochondrial energy metabolism through its effects on CoA transport and availability. Based on studies of human SLC25A42 deficiency, several key metabolic consequences can be anticipated in mouse models:

Disruption of CoA-Dependent Metabolic Pathways:

  • Impaired Fatty Acid Oxidation:

    • CoA is essential for the esterification of fatty acids used in mitochondrial β-oxidation .

    • SLC25A42 deficiency results in reduced utilization of palmitate in functional mitochondrial assays, indicating compromised fatty acid oxidation .

    • This suggests that Slc25a42-deficient mouse models would likely show accumulation of fatty acids and reduced ability to utilize fat as an energy source.

  • TCA Cycle Dysfunction:

    • Multiple steps in the TCA cycle require CoA-derived cofactors (e.g., acetyl-CoA, succinyl-CoA).

    • Reduced mitochondrial CoA availability would impair TCA cycle flux, reducing the generation of reducing equivalents for oxidative phosphorylation.

  • Lactic Acidosis and Metabolic Shift:

    • Human patients with SLC25A42 deficiency present with lactic acidosis .

    • Elevated lactate production indicates a shift from oxidative phosphorylation to glycolytic ATP generation, compensating for impaired mitochondrial energy production.

Mitochondrial Function and Bioenergetics:

  • Reduced Oxygen Consumption:

    • Patients with SLC25A42 deficiency show reduced oxygen consumption rates in muscle and fibroblasts .

    • This reflects compromised electron transport chain function and oxidative phosphorylation.

    • Mouse models would likely demonstrate similar reductions in basal respiration, ATP production, and maximal respiratory capacity.

  • Energy Crisis During Metabolic Stress:

    • Clinical data suggest that SLC25A42 deficiency becomes particularly problematic during periods of high energy demand, such as infections with febrile progression .

    • This indicates that Slc25a42-deficient mice may show relatively normal function under basal conditions but decompensate under metabolic stress (fasting, exercise, infection).

Tissue-Specific Effects:

  • Neurological Impact:

    • Human patients show neurological manifestations including developmental delay, encephalopathy, and symmetrical T2 hyperintensity of the putamen on brain MRI .

    • Mouse models would likely show analogous neurological phenotypes due to the high energy demands of neural tissue.

  • Myopathy:

    • Muscle involvement is common in human SLC25A42 deficiency .

    • Mouse models would likely exhibit reduced exercise tolerance, muscle weakness, and potentially structural abnormalities in muscle tissue.

Therapeutic Considerations:

  • Response to Pantothenic Acid:

    • Administration of high-dose pantothenic acid (vitamin B5, the precursor to CoA) leads to clinical stabilization and increased CoA levels in fibroblasts from patients with SLC25A42 deficiency .

    • This suggests that mouse models might respond similarly to pantothenic acid supplementation, providing a potential therapeutic approach.

  • Dietary Modifications:

    • Given the impaired utilization of fatty acids, a low-fat diet might aid in maintaining energy homeostasis in Slc25a42-deficient mice .

    • Ketogenic diets, which rely heavily on fatty acid metabolism, would likely be poorly tolerated.

Understanding these metabolic consequences in mouse models will provide valuable insights into the pathophysiology of SLC25A42 deficiency and facilitate the development and testing of targeted therapeutic approaches.

What experimental approaches can detect potential interactions between Slc25a42 and other mitochondrial proteins?

Investigating the protein interaction network of Slc25a42 is essential for understanding its functional context within the mitochondrial proteome. The following experimental approaches are recommended for detecting and characterizing these interactions:

In Vitro Interaction Studies:

  • Co-Immunoprecipitation (Co-IP):

    • Express epitope-tagged Slc25a42 (HA, FLAG, etc.) in appropriate cell lines or tissues.

    • Solubilize mitochondrial membranes using mild detergents that preserve protein-protein interactions.

    • Immunoprecipitate Slc25a42 using tag-specific antibodies.

    • Identify co-precipitating proteins by mass spectrometry or Western blotting.

    • Validate specific interactions by reverse Co-IP and by demonstrating that the interaction is disrupted under denaturing conditions.

  • Proximity Labeling Techniques:

    • Fuse Slc25a42 to enzymes like BioID (biotin ligase) or APEX2 (ascorbate peroxidase).

    • Express the fusion protein in cells, allowing it to biotinylate or otherwise label proteins in close proximity.

    • Purify labeled proteins using streptavidin-based affinity chromatography.

    • Identify interacting partners by mass spectrometry.

    • This approach is particularly valuable for membrane proteins like Slc25a42 and can capture transient interactions.

In Situ Visualization of Interactions:

  • Fluorescence Resonance Energy Transfer (FRET):

    • Generate fusion constructs of Slc25a42 and potential interacting partners with appropriate fluorophores (CFP/YFP, GFP/RFP).

    • Express these constructs in cells and measure FRET efficiency.

    • A positive FRET signal indicates that proteins are within 10 nm of each other, suggesting physical interaction.

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse Slc25a42 and candidate interacting proteins to complementary fragments of a fluorescent protein.

    • If the proteins interact, the fragments come together to reconstitute fluorescence.

    • This technique provides spatial information about where in the cell the interaction occurs.

Functional Interaction Studies:

  • Genetic Interaction Assays:

    • Perform epistasis analysis by generating double knockdown/knockout models.

    • Synthetic lethality or enhancement of phenotypes suggests functional interaction between genes.

    • This approach can reveal functional relationships even in the absence of direct physical interaction.

  • Liposome Reconstitution with Multiple Proteins:

    • Co-reconstitute purified Slc25a42 with other mitochondrial proteins into liposomes.

    • Assess whether transport activity is modulated by the presence of other proteins.

    • This can reveal functional interactions that affect transport kinetics.

Computational Approaches to Complement Experimental Data:

  • Network Analysis:

    • Use bioinformatics tools to predict potential interactions based on co-expression data, evolutionary conservation, or structural features.

    • These predictions can guide experimental design by identifying high-probability interacting partners.

  • Structural Modeling:

    • Generate docking models of Slc25a42 with potential interacting partners.

    • Predict interaction interfaces that can be validated experimentally through mutagenesis.

Potential interacting partners to investigate include other mitochondrial carriers, enzymes involved in CoA synthesis and utilization, components of the fatty acid oxidation machinery, and proteins involved in mitochondrial dynamics or quality control. By employing multiple complementary approaches, researchers can build a comprehensive picture of the Slc25a42 interactome.

How can isotope labeling be used to track CoA transport and metabolism in Slc25a42 models?

Isotope labeling provides powerful tools for tracking CoA transport and metabolism in Slc25a42 models, offering insights into the functional consequences of Slc25a42 deficiency or modification. The following methodological approaches are recommended:

In Vitro Transport Assays with Isotope-Labeled Substrates:

  • Radiolabeled Substrate Transport:

    • Use [14C]CoA, [3H]CoA, or isotope-labeled CoA derivatives for transport assays with purified and reconstituted Slc25a42.

    • Measure the uptake of labeled substrates into proteoliposomes over time.

    • Compare transport rates between wild-type and mutant Slc25a42 or in the presence of potential inhibitors .

  • Competition Assays:

    • Perform transport assays with radiolabeled CoA in the presence of unlabeled potential substrates.

    • The degree of inhibition indicates the relative affinity of the carrier for different substrates.

    • This approach can define the substrate specificity profile of Slc25a42.

Cellular Metabolic Flux Analysis:

  • [13C]Pantothenate Labeling:

    • Supply cells or tissues with [13C]pantothenate (vitamin B5), the precursor to CoA.

    • Track the incorporation of 13C into CoA and CoA-derived metabolites using liquid chromatography-mass spectrometry (LC-MS).

    • Compare labeling patterns between wild-type and Slc25a42-deficient models to assess differences in CoA synthesis and compartmentalization.

  • Subcellular Fractionation with Isotope Labeling:

    • Label cells with isotope-tagged CoA precursors.

    • Isolate mitochondrial and cytosolic fractions.

    • Measure the distribution of labeled CoA between compartments.

    • This directly assesses the impact of Slc25a42 deficiency on mitochondrial CoA import.

Metabolic Pathway Analysis:

  • [13C]Glucose or [13C]Fatty Acid Tracing:

    • Supply cells with [13C]glucose or [13C]palmitate.

    • Analyze the labeling patterns of TCA cycle intermediates, fatty acid metabolites, and amino acids.

    • This reveals how Slc25a42 deficiency affects central carbon metabolism and substrate utilization.

  • Pulse-Chase Experiments:

    • Perform a short pulse with labeled substrate followed by a chase with unlabeled substrate.

    • This approach provides information about metabolic flux rates and turnover of CoA-dependent pathways.

In Vivo Metabolic Tracing:

  • Stable Isotope Resolved Metabolomics (SIRM):

    • Administer [13C]glucose, [13C]fatty acids, or other labeled precursors to mice.

    • Collect tissues at various time points.

    • Analyze isotopomer distributions in metabolites across different tissues.

    • This provides a comprehensive view of whole-body metabolism in Slc25a42 mouse models.

  • Positron Emission Tomography (PET):

    • Use 11C-labeled substrates for non-invasive imaging of metabolic processes in living animals.

    • Compare substrate utilization patterns between wild-type and Slc25a42-deficient mice.

Data Analysis and Interpretation:

  • Isotopomer Analysis:

    • Analyze mass isotopomer distributions to determine the relative activities of different metabolic pathways.

    • This requires specialized software and mathematical modeling approaches.

  • Metabolic Flux Modeling:

    • Incorporate isotope labeling data into computational models of metabolism.

    • Estimate flux rates through different pathways and identify rate-limiting steps affected by Slc25a42 deficiency.

These isotope labeling approaches provide mechanistic insights into how Slc25a42 deficiency affects CoA transport and metabolism, helping to elucidate the molecular basis of associated pathologies and guide the development of therapeutic strategies.

How can pantothenic acid supplementation be optimized as a potential therapeutic approach for Slc25a42 deficiency?

Optimizing pantothenic acid (vitamin B5) supplementation as a therapeutic approach for Slc25a42 deficiency requires careful consideration of dosing, delivery, and monitoring parameters. Based on clinical observations in human SLC25A42 deficiency, the following methodological framework is recommended:

Establishing Effective Dosing Regimens:

  • Dose-Response Studies:

    • Conduct in vitro experiments with fibroblasts or other relevant cell types from Slc25a42-deficient models.

    • Test multiple concentrations of pantothenic acid to determine the minimum effective dose.

    • Human studies have used doses approximately 100 times higher than the normal daily requirement (5 mg/day in adolescents) .

    • For mouse models, scale dosing appropriately based on body weight and metabolic rate.

  • Timing and Administration:

    • Determine optimal administration frequency (daily vs. multiple times per day).

    • Compare different routes of administration (oral, intraperitoneal) for efficacy.

    • Assess whether continuous supplementation is required or if intermittent high-dose regimens are effective.

Monitoring Treatment Efficacy:

  • Biochemical Markers:

    • Measure CoA levels in accessible tissues or cells (e.g., fibroblasts, blood cells).

    • Human studies have shown that pantothenic acid supplementation increases CoA levels in fibroblasts from patients with SLC25A42 deficiency .

    • Monitor lactate levels, which are typically elevated in SLC25A42 deficiency .

  • Functional Assessments:

    • Measure oxygen consumption rates and extracellular acidification rates using platforms like Seahorse XF Analyzer.

    • Assess fatty acid oxidation capacity using radiolabeled palmitate or other fatty acid substrates.

    • These parameters directly reflect mitochondrial function and energy metabolism.

  • Tissue-Specific Markers:

    • For neurological manifestations, monitor appropriate behavioral and cognitive parameters in mouse models.

    • For myopathy, assess muscle strength, endurance, and recovery after exercise.

    • These clinical parameters provide functional correlates to biochemical improvements.

Mechanistic Understanding:

  • Compartment-Specific Analysis:

    • Determine whether pantothenic acid supplementation increases cytosolic CoA, mitochondrial CoA, or both.

    • This is critical for understanding the mechanism of therapeutic effect, as it remains unclear whether increased cytosolic CoA leads to increased mitochondrial CoA in the context of Slc25a42 deficiency .

  • Compensatory Pathway Investigation:

    • Investigate whether high doses of pantothenic acid activate alternative transport mechanisms for CoA.

    • Explore potential changes in gene expression or protein levels of other mitochondrial carriers that might compensate for Slc25a42 deficiency.

Combination Therapies:

  • Dietary Modifications:

    • Explore whether combining pantothenic acid supplementation with a low-fat diet enhances therapeutic efficacy.

    • This approach targets both CoA availability and reduces demand on fatty acid oxidation pathways that may be compromised .

  • Synergistic Supplements:

    • Test combinations with other B vitamins or mitochondrial cofactors.

    • Evaluate potential synergistic effects with antioxidants or mitochondrial targeted therapies.

Translational Considerations:

  • Critical Periods:

    • Determine whether there are developmental windows during which treatment is most effective.

    • This is particularly relevant for neurodevelopmental aspects of SLC25A42 deficiency.

  • Long-Term Safety:

    • Monitor for potential adverse effects of long-term high-dose pantothenic acid supplementation.

    • Assess whether tolerance develops with prolonged treatment, necessitating dose adjustments.

By systematically addressing these aspects, researchers can develop optimized pantothenic acid supplementation regimens for Slc25a42 deficiency that maximize therapeutic efficacy while minimizing potential adverse effects. This approach builds upon the promising clinical observations in human patients, where pantothenic acid supplementation led to clinical stabilization and increased CoA levels .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.