Recombinant Mouse Solute carrier family 25 member 44 (Slc25a44)

Shipped with Ice Packs
In Stock

Description

Protein Characteristics

Recombinant Mouse SLC25A44 (UniProt ID: Q8BGF9) is a 35.3 kDa protein comprising amino acids 1–314, synthesized using the ALiCE® (Almost Living Cell-Free Expression) system derived from Nicotiana tabacum. Key features include:

PropertyDetail
Expression SystemCell-free protein synthesis (CFPS)
Purification TagStrep Tag (affinity chromatography)
Purity>70–80% (SDS-PAGE, Western Blot, HPLC-SEC)
ApplicationsELISA, SDS-PAGE, Western Blot, functional assays
Storage-80°C in PBS pH 7.4 with 10% glycerol
Molecular FunctionMitochondrial BCAA transport

Biological Role in Mitochondrial BCAA Metabolism

SLC25A44 facilitates the transport of BCAAs (valine, leucine, isoleucine) into mitochondria, where they are oxidized to fuel thermogenesis in brown adipose tissue (BAT) . Key findings include:

  • Thermogenesis Regulation: BAT-specific knockout (KO) mice showed a 70% reduction in mitochondrial BCAA oxidation, impairing fever responses to prostaglandin E₂ and cold adaptation .

  • Metabolic Flexibility: SLC25A44 enables BAT to switch between glucose, fatty acids, and BCAAs as energy sources during stress. Loss of SLC25A44 disrupts TCA cycle intermediates and mitochondrial amino acid synthesis .

  • Systemic BCAA Clearance: BAT-mediated BCAA catabolism via SLC25A44 reduces circulating BCAA levels, which are linked to insulin resistance and obesity .

Functional Studies

  • In Vitro Assays: Recombinant SLC25A44 is enzymatically active in BCAA transport, as validated by oocyte uptake experiments and mitochondrial respiration assays .

  • In Vivo Models: BAT-specific KO mice (generated via Ucp1-Cre × Slc25a44 flox/flox crosses) revealed blunted non-shivering thermogenesis and defective febrile responses .

Technical Advantages of Recombinant SLC25A44

  • Custom Production: Made-to-order synthesis ensures soluble protein delivery without financial risk if expression fails .

  • Post-Translational Modifications: The ALiCE® system preserves native folding and modifications, enhancing functional accuracy .

Clinical and Therapeutic Implications

  • Metabolic Diseases: Impaired SLC25A44 activity correlates with obesity and diabetes, suggesting therapeutic potential via enhancing BCAA oxidation .

  • Fever Management: Targeting SLC25A44 could modulate febrile responses by rewiring mitochondrial BCAA utilization .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Slc25a44; Solute carrier family 25 member 44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a44
Target Protein Sequence
MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDA FVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSAS LVAQSITVPIDVVSQHLMMQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLR GFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSRLCPQECPHIVFQAISGPLAAATASILT NPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLK KLSLRPELVDSRHW
Uniprot No.

Target Background

Function
Mitochondrial solute transporter responsible for transporting branched-chain amino acids (BCAA; valine, leucine, and isoleucine) into mitochondria within brown adipose tissue (BAT). BAT plays a crucial role in BCAA catabolism and actively utilizes BCAA in the mitochondria for thermogenesis.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in brown adipose tissues compared with other metabolic organs.

Q&A

What is Slc25a44 and what is its primary function?

Slc25a44 is a recently identified mitochondrial branched-chain amino acid (BCAA) carrier (MBC) that facilitates the import of BCAAs into the mitochondrial matrix for subsequent catabolic reactions. It plays a crucial role in the regulation of mitochondrial BCAA catabolism and is essential for the adaptive response to fever in rodents . As a member of the solute carrier family 25, Slc25a44 is part of a group of membrane transporters that mediate the movement of metabolites across the inner mitochondrial membrane.

In which tissues is Slc25a44 predominantly expressed?

Slc25a44 is widely expressed across multiple tissues, with notable expression in the brain, skeletal muscle, and brown adipose tissue (BAT) . The expression pattern suggests its importance in tissues with high metabolic activity and energy demands. The ubiquitous yet differential expression across tissues indicates tissue-specific roles in BCAA metabolism and energy homeostasis.

How does Slc25a44 contribute to metabolic flexibility?

Slc25a44 contributes to metabolic flexibility by regulating the mitochondrial import of BCAAs, which can serve as alternative fuel sources during various physiological stresses. Research has demonstrated that Slc25a44 is particularly important during fever response and thermogenesis, where enhanced BCAA oxidation in BAT is observed . This metabolic adaption allows cells to shift between different fuel sources based on physiological demands and environmental conditions.

What are the most effective methods for generating Slc25a44 knockout models?

Based on the current research, the most effective methods for generating Slc25a44 knockout models include:

  • Tissue-specific knockout using Cre-lox system: Researchers have successfully generated BAT-specific Slc25a44 knockout mice by crossing Slc25a44 floxed mice with Ucp1-Cre mice (Ucp1-Cre × Slc25a44 flox/flox) . This approach allows for tissue-specific investigation of Slc25a44 function.

  • CRISPRi-mediated depletion: Studies have utilized CRISPRi technology to deplete Slc25a44, which decreased mitochondrial BCAA oxidation and attenuated systemic BCAA clearance in mice .

  • Cell line models: For in vitro studies, researchers have used immortalized preadipocytes isolated from BAT of Slc25a44 flox/flox mice, which were subsequently infected with a retrovirus containing either empty vector or Cre, followed by hygromycin selection .

Each method offers distinct advantages depending on the research question. Tissue-specific knockouts are particularly valuable when investigating the role of Slc25a44 in specific physiological contexts while avoiding potential developmental or systemic effects.

What are the key considerations when designing experiments to study Slc25a44 function?

When designing experiments to study Slc25a44 function, researchers should consider:

  • Selection of appropriate controls: Littermate controls (Slc25a44 flox/flox without Cre) are essential for tissue-specific knockout studies to account for genetic background effects .

  • Acclimation conditions: For studies on thermogenesis or fever response, proper acclimation to specific temperatures (e.g., thermoneutral temperature at 30°C or cold temperature at 15°C) is crucial .

  • Functional validation: Confirmation of reduced BCAA oxidation in target tissues is essential for validating the knockout model. For example, BAT-specific Slc25a44 knockout reduced valine oxidation by approximately 70% in BAT .

  • Phenotypic assessment: Comprehensive phenotypic assessment including body weight, tissue mass, morphological analysis, and functional readouts specific to the tissue of interest should be performed .

  • Consideration of compensatory mechanisms: Potential compensatory upregulation of alternative metabolic pathways should be investigated, particularly in long-term studies.

How can researchers effectively measure BCAA oxidation to assess Slc25a44 function?

To effectively measure BCAA oxidation and assess Slc25a44 function, researchers can employ the following methodologies:

  • Radioactive tracer studies: Measuring the oxidation of radiolabeled BCAAs (e.g., [14C]-valine) provides a direct assessment of BCAA catabolism in tissues of interest .

  • Oxygen consumption rate (OCR) measurements: Using a Seahorse XFe Extracellular Flux Analyzer to measure OCR in cultured adipocytes in the presence and absence of BCAAs can provide insights into BCAA-dependent respiratory capacity .

  • Metabolomic profiling: Analysis of TCA cycle intermediates and related metabolites can indirectly assess BCAA metabolism and mitochondrial function.

  • Gene and protein expression analysis: Quantification of enzymes involved in BCAA catabolism using qRT-PCR and immunoblotting provides complementary data on the BCAA catabolic pathway activity .

A comprehensive approach combining these methodologies provides the most robust assessment of Slc25a44 function in BCAA metabolism.

How does Slc25a44 deficiency affect cell-specific metabolism and physiological responses?

Slc25a44 deficiency has significant cell-specific effects on metabolism and physiological responses, particularly in thermogenic tissues:

  • Impact on BAT thermogenesis: BAT-specific Slc25a44 knockout mice exhibit impaired non-shivering thermogenesis following intracerebroventricular PGE2 administration, highlighting the importance of Slc25a44 in febrile responses .

  • Cellular metabolic reprogramming: At the cellular level, Slc25a44 is required for:

    • Mitochondrial BCAA deamination

    • Synthesis of mitochondrial amino acids

    • Production of TCA cycle intermediates

  • Tissue-specific metabolic alterations: While BAT shows pronounced effects, other tissues may exhibit different metabolic adaptations to Slc25a44 deficiency, reflecting tissue-specific roles of this transporter.

The table below summarizes the key phenotypic differences observed in BAT-specific Slc25a44 knockout mice compared to control mice:

ParameterControl MiceBAT-specific Slc25a44 KO MiceSignificance
Valine oxidation in BAT100%Reduced by ~70%p < 0.05
Body weightNormalNo significant changeN.S.
BAT morphologyNormalNo major differenceN.S.
Thermogenic response to PGE2NormalImpairedp < 0.05
BCAA oxidation in skeletal muscleNormalNo changeN.S.

Data derived from research findings reported in the literature .

What are the metabolic consequences of altered Slc25a44 expression in different physiological states?

The metabolic consequences of altered Slc25a44 expression vary significantly depending on physiological states:

  • Febrile response: Slc25a44 is critical for optimal febrile responses. Mitochondrial BCAA oxidation in BAT is significantly enhanced during fever in response to pyrogenic mediators like prostaglandin E2 (PGE2). BAT-specific deletion of Slc25a44 blunts this response .

  • Cold adaptation: Slc25a44-mediated BCAA metabolism contributes to cold adaptation. Decreased mitochondrial BCAA oxidation due to Slc25a44 depletion attenuates cold tolerance in mice .

  • Stress response: Psychological stress increases BCAA oxidation in BAT, suggesting that Slc25a44 may play a role in metabolic adaptation to psychological stressors .

  • Normal physiological conditions: Under basal conditions, BAT-specific Slc25a44 knockout does not significantly alter body weight, tissue mass, or brown adipocyte morphology, suggesting compensatory mechanisms may exist under non-challenged conditions .

These differential effects highlight the context-dependent role of Slc25a44 in metabolic regulation and stress adaptation.

How do other mitochondrial carriers interact with Slc25a44 in regulating cellular metabolism?

The interaction between Slc25a44 and other mitochondrial carriers creates a complex regulatory network governing cellular metabolism:

  • Coordination with MPC (Mitochondrial Pyruvate Carrier): Similar to how MPC regulates mitochondrial pyruvate uptake and oxidation, Slc25a44 controls BCAA import and catabolism. The relative activities of these carriers may determine substrate preference for mitochondrial oxidation .

  • Complementary roles in fuel selection: Various mitochondrial carriers, including Slc25a44, collectively determine the metabolic flexibility of cells by regulating the import of different substrates into mitochondria. This allows for adaptive fuel selection during different physiological states .

  • Potential compensatory mechanisms: In the absence of Slc25a44, cells may upregulate alternative substrate utilization pathways through other mitochondrial carriers, although this compensation appears incomplete given the phenotypic consequences of Slc25a44 deficiency .

Research on the interplay between different mitochondrial carriers represents an important frontier in understanding cellular metabolic regulation and flexibility.

What are the key challenges in expressing and purifying recombinant Slc25a44 for functional studies?

Expressing and purifying functional recombinant membrane proteins like Slc25a44 presents several challenges:

  • Expression system selection: Membrane proteins often require eukaryotic expression systems for proper folding and post-translational modifications. Expression in E. coli may result in inclusion bodies requiring refolding protocols, while mammalian or insect cell systems may provide better native-like protein but with lower yields.

  • Detergent selection: The choice of detergent for solubilization is critical for maintaining Slc25a44 in a functional state. A systematic screening of different detergents is often necessary to identify optimal conditions.

  • Functional validation: Unlike soluble proteins, functional assays for membrane transporters like Slc25a44 require reconstitution into liposomes or other membrane-mimetic systems to assess transport activity.

  • Protein stability: Mitochondrial carriers are often unstable outside their native membrane environment, necessitating careful optimization of buffer conditions, including pH, salt concentration, and stabilizing additives.

  • Structural characterization: Obtaining structural information may require specialized techniques such as cryo-electron microscopy rather than traditional X-ray crystallography due to the challenges in crystallizing membrane proteins.

Researchers should consider these factors when planning recombinant Slc25a44 studies and may benefit from adapting protocols used for related mitochondrial carriers.

How can researchers accurately quantify Slc25a44 expression and localization in different tissues?

Accurate quantification of Slc25a44 expression and localization requires a combination of complementary approaches:

  • mRNA quantification:

    • qRT-PCR using validated primers specific to Slc25a44

    • Normalization to stable reference genes (e.g., 36B4 has been used in previous studies)

    • RNA-Seq for genome-wide expression analysis

  • Protein detection:

    • Immunoblotting with specific antibodies against Slc25a44

    • Use of tissue-specific markers as controls (e.g., UCP1 for BAT)

    • Quantitative proteomics approaches for relative quantification

  • Subcellular localization:

    • Immunofluorescence microscopy with co-staining for mitochondrial markers

    • Subcellular fractionation followed by immunoblotting

    • Electron microscopy with immunogold labeling for high-resolution localization

  • Validation strategies:

    • Use of knockout or knockdown tissues/cells as negative controls

    • Comparison of multiple antibodies targeting different epitopes

    • Correlation of protein and mRNA expression data

A methodical approach combining these techniques provides the most comprehensive and reliable assessment of Slc25a44 expression and localization patterns.

What are the optimal conditions for assessing Slc25a44-mediated BCAA transport in isolated mitochondria?

Optimizing conditions for assessing Slc25a44-mediated BCAA transport in isolated mitochondria requires careful consideration of several parameters:

  • Mitochondrial isolation protocol:

    • Fresh isolation from relevant tissues (BAT, brain, or skeletal muscle)

    • Gentle isolation methods to maintain mitochondrial integrity

    • Quality control assessment of mitochondrial preparations (respiratory control ratio, membrane potential)

  • Transport assay buffer composition:

    • HEPES-KOH buffer (pH 7.4) with physiological KCl concentration (0.1 M)

    • Addition of BSA (1 mg/mL) to stabilize membranes

    • Inclusion of protease inhibitors to prevent protein degradation

  • Substrate considerations:

    • Use of radiolabeled BCAAs at concentrations ranging from physiological (low μM) to saturating (mM)

    • Inclusion of appropriate controls (non-labeled BCAAs for competition studies)

    • Time-course measurements to distinguish transport from metabolism

  • Temperature and incubation time:

    • Standardized temperature (typically 30°C for mitochondrial assays)

    • Optimal incubation time of 30 minutes for transport assays

  • Analysis methods:

    • Rapid filtration techniques to separate mitochondria from reaction mixture

    • Scintillation counting for quantification of radiolabeled substrates

    • Appropriate normalization to mitochondrial protein content

By systematically optimizing these conditions, researchers can establish reliable assays for Slc25a44-mediated BCAA transport that distinguish between transport activity and subsequent metabolism.

How should researchers interpret discrepancies between in vitro and in vivo studies of Slc25a44 function?

When encountering discrepancies between in vitro and in vivo studies of Slc25a44 function, researchers should consider several factors:

  • Microenvironment differences:

    • In vitro systems lack the complex intercellular and hormonal regulation present in vivo

    • Cell culture conditions may not recapitulate the physiological nutrient and oxygen levels

    • These differences may significantly impact Slc25a44 expression, localization, or activity

  • Compensatory mechanisms:

    • In vivo systems can develop compensatory pathways over time that are absent in acute in vitro models

    • Chronic loss of Slc25a44 in vivo may trigger alternative BCAA utilization pathways

    • Assessment of these compensatory responses requires comprehensive metabolic profiling

  • Methodological considerations:

    • Different detection methods may have varying sensitivities and specificities

    • The remaining 30% of BCAA oxidation in BAT of Slc25a44 knockout mice may arise from UCP1-negative cells that avoid Slc25a44 deletion

    • Technical variables in measuring BCAA oxidation may contribute to apparent discrepancies

  • Systematic approach to resolution:

    • Validate findings using multiple complementary techniques

    • Bridge the gap with intermediate models (ex vivo tissue slices, organoids)

    • Perform time-course studies to distinguish acute from chronic effects

By carefully evaluating these factors, researchers can develop a more nuanced understanding of Slc25a44 function that reconciles apparent contradictions between experimental systems.

What are common pitfalls in analyzing the metabolic effects of Slc25a44 manipulation, and how can they be avoided?

Common pitfalls in analyzing the metabolic effects of Slc25a44 manipulation and strategies to avoid them include:

  • Incomplete phenotypic characterization:

    • Pitfall: Focusing exclusively on expected phenotypes while missing broader metabolic adaptations

    • Solution: Perform comprehensive metabolomic profiling, assess multiple tissues, and examine effects under various physiological challenges

  • Inadequate controls:

    • Pitfall: Using inappropriate control groups that don't account for genetic background effects

    • Solution: Use littermate controls and include both positive and negative controls in all experiments

  • Confounding factors in temperature-dependent studies:

    • Pitfall: Failing to control for environmental temperature when studying thermogenic responses

    • Solution: Ensure proper acclimation to defined temperatures for all experimental groups

  • Attribution errors:

    • Pitfall: Attributing all observed effects directly to Slc25a44 without considering secondary effects

    • Solution: Perform time-course studies to distinguish primary from secondary effects and use rescue experiments to confirm causality

  • Methodological limitations in BCAA oxidation measurements:

    • Pitfall: Relying on a single method to assess BCAA metabolism

    • Solution: Combine direct measures of BCAA oxidation with assessment of downstream metabolites and respiratory capacity

A systematic approach that anticipates these common challenges can significantly enhance the reliability and interpretability of data from Slc25a44 studies.

How can researchers distinguish between the direct effects of Slc25a44 on BCAA transport versus secondary metabolic consequences?

Distinguishing between direct effects of Slc25a44 on BCAA transport and secondary metabolic consequences requires a strategic experimental approach:

  • Acute versus chronic manipulations:

    • Acute inhibition or activation of Slc25a44 (e.g., using inducible systems) primarily reveals direct transport effects

    • Chronic genetic modifications may show a combination of direct effects and compensatory adaptations

    • Comparing acute and chronic effects can help delineate primary from secondary consequences

  • Direct transport assays:

    • Reconstitution of purified Slc25a44 in liposomes for direct transport measurements

    • Use of isolated mitochondria for transport studies with rapid time points before significant metabolism occurs

    • Competition assays with non-metabolizable BCAA analogs to focus specifically on transport function

  • Metabolic flux analysis:

    • Isotope tracing studies to track the fate of BCAAs through various metabolic pathways

    • Time-resolved measurements to distinguish initial transport from subsequent metabolic steps

    • Comparison of intramitochondrial versus cytosolic BCAA levels and metabolites

  • Complementary approaches:

    • Structure-function studies using point mutations that affect transport but not protein stability

    • Correlation analysis between transport kinetics and downstream metabolic effects

    • Assessment of mitochondrial metabolite profiles before and after BCAA addition

Through this multi-faceted approach, researchers can develop a more precise understanding of how Slc25a44's primary transport function relates to the broader metabolic phenotypes observed in experimental models.

What are the most promising therapeutic applications for targeting Slc25a44 in metabolic disorders?

Based on current understanding of Slc25a44 function, several promising therapeutic applications for targeting this transporter in metabolic disorders include:

  • Thermogenic regulation for obesity treatment:

    • Modulating Slc25a44 activity could potentially enhance BAT thermogenesis and energy expenditure

    • This approach may be particularly relevant for obesity treatment, especially in individuals with reduced BAT activity

  • Fever management strategies:

    • Since Slc25a44 plays a crucial role in febrile responses, selective inhibitors might help control excessive or prolonged fever in certain pathological conditions

    • This could offer an alternative approach to traditional antipyretics

  • BCAA metabolism disorders:

    • Targeting Slc25a44 might help address conditions characterized by abnormal BCAA metabolism

    • Potential applications in maple syrup urine disease (MSUD) or other inborn errors of BCAA metabolism

  • Metabolic flexibility enhancement:

    • Stimulating Slc25a44 activity could potentially improve metabolic flexibility in conditions like insulin resistance or type 2 diabetes

    • This might facilitate better adaptation to different metabolic demands and nutrient availability

Future research should focus on developing specific modulators of Slc25a44 activity and evaluating their effects in relevant disease models.

What emerging technologies could advance our understanding of Slc25a44 structure-function relationships?

Emerging technologies that could significantly advance our understanding of Slc25a44 structure-function relationships include:

  • Cryo-electron microscopy (Cryo-EM):

    • High-resolution structural determination of membrane proteins without crystallization

    • Potential to capture Slc25a44 in different conformational states during the transport cycle

    • Insights into substrate binding sites and conformational changes

  • AlphaFold and related AI structure prediction tools:

    • Computational prediction of Slc25a44 structure with increasing accuracy

    • Ability to model protein-substrate interactions and identify critical residues

    • Rapid screening of potential structural impacts of mutations

  • Single-molecule techniques:

    • Real-time monitoring of individual Slc25a44 transporters in action

    • Characterization of transport kinetics and conformational dynamics

    • Correlation of structural states with functional outcomes

  • CRISPR-based high-throughput mutagenesis:

    • Systematic creation and characterization of Slc25a44 variants

    • Identification of residues critical for substrate specificity and transport efficiency

    • Generation of structure-function maps across the entire protein

  • Advanced metabolic imaging:

    • Visualization of BCAA transport and metabolism in real-time using fluorescent or radiographic tracers

    • Spatial and temporal resolution of Slc25a44 activity in different subcellular compartments

    • Integration with other metabolic pathways at the single-cell level

These technologies, especially when used in combination, promise to provide unprecedented insights into how Slc25a44 structure determines its function in BCAA transport and metabolism.

How might Slc25a44 function be affected by various physiological and pathological conditions beyond fever response?

Slc25a44 function may be significantly modulated by various physiological and pathological conditions beyond fever response:

  • Metabolic stress conditions:

    • Caloric restriction might upregulate Slc25a44 to enhance BCAA utilization for energy production

    • High-fat diets may alter Slc25a44 expression or activity, potentially contributing to metabolic inflexibility

    • Exercise training could modify Slc25a44 function to improve metabolic adaptation in skeletal muscle

  • Inflammatory states:

    • Chronic inflammation may dysregulate Slc25a44, affecting BCAA metabolism in multiple tissues

    • Inflammatory cytokines might directly or indirectly modulate Slc25a44 expression and activity

    • This could contribute to metabolic disturbances observed in inflammatory disorders

  • Aging process:

    • Age-related changes in mitochondrial function might include alterations in Slc25a44 activity

    • Declining BCAA metabolism with age could partially result from reduced Slc25a44 function

    • Interventions targeting Slc25a44 might potentially address aspects of age-related metabolic decline

  • Neurodegenerative conditions:

    • Given Slc25a44's expression in the brain, its dysfunction might contribute to metabolic aspects of neurodegenerative diseases

    • Altered BCAA metabolism has been implicated in several neurological disorders

    • Investigating Slc25a44 in neural tissues could reveal new insights into brain energy metabolism

Future research investigating Slc25a44 regulation and function across these diverse conditions will likely uncover novel roles for this transporter in health and disease.

How does Slc25a44 fit into our broader understanding of mitochondrial metabolism and cellular energy homeostasis?

Slc25a44 represents a critical component in the complex regulatory network governing mitochondrial metabolism and cellular energy homeostasis:

  • Metabolic substrate selection: Slc25a44 adds another layer to our understanding of how cells regulate substrate utilization by controlling mitochondrial BCAA import. This complements other mitochondrial carriers such as the mitochondrial pyruvate carrier (MPC), which regulates pyruvate entry .

  • Integration with metabolic sensing pathways: The regulation of Slc25a44 likely involves integration with cellular nutrient sensing mechanisms, allowing for coordinated responses to changing metabolic conditions.

  • Tissue-specific metabolic programming: The differential expression and regulation of Slc25a44 across tissues contributes to tissue-specific metabolic capabilities and adaptations. This is particularly evident in thermogenic tissues like BAT .

  • Metabolic flexibility nexus: By controlling BCAA availability for mitochondrial catabolism, Slc25a44 represents a key checkpoint in metabolic flexibility, allowing cells to switch between different fuel sources based on physiological needs .

  • Evolutionary conservation: The conservation of this transport mechanism highlights the fundamental importance of regulated BCAA metabolism in cellular energy homeostasis across species.

This integrative understanding positions Slc25a44 as not merely a transporter but a crucial regulatory node in cellular metabolism with significant implications for physiological adaptation and disease processes.

What are the key unanswered questions regarding Slc25a44 function and regulation?

Despite significant advances, several key questions regarding Slc25a44 function and regulation remain unanswered:

  • Regulatory mechanisms:

    • What transcriptional, post-transcriptional, and post-translational mechanisms regulate Slc25a44 expression and activity?

    • How do hormonal signals and metabolic states influence Slc25a44 function?

    • Are there specific binding partners or regulatory proteins that modulate its transport activity?

  • Substrate specificity:

    • Beyond the canonical BCAAs, does Slc25a44 transport other amino acids or metabolites?

    • What structural features determine its substrate selectivity?

    • How does Slc25a44 discriminate between different BCAAs and potentially related compounds?

  • Pathophysiological roles:

    • How is Slc25a44 function altered in metabolic diseases such as obesity, diabetes, or BCAA metabolism disorders?

    • Does Slc25a44 dysfunction contribute to the pathogenesis of these conditions?

    • Are there human genetic variants affecting Slc25a44 function with clinical significance?

  • Therapeutic potential:

    • Can Slc25a44 be effectively targeted pharmacologically?

    • What would be the consequences of selective activation or inhibition of Slc25a44 in different tissues?

    • How might Slc25a44 modulation interact with other metabolic interventions?

Addressing these questions will require interdisciplinary approaches combining structural biology, biochemistry, cell biology, genetics, and physiology to fully elucidate the multifaceted roles of this important mitochondrial transporter.

How can researchers integrate Slc25a44 studies with broader investigations of BCAA metabolism in health and disease?

Integrating Slc25a44 studies with broader investigations of BCAA metabolism requires strategic approaches that connect molecular mechanisms to physiological outcomes:

By adopting these integrative approaches, researchers can position Slc25a44 studies within the broader context of BCAA metabolism, potentially uncovering new insights into metabolic regulation and disease mechanisms while identifying novel therapeutic targets.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.