Recombinant Mouse Solute carrier family 25 member 47 (Slc25a47)

Shipped with Ice Packs
In Stock

Description

Expression and Localization

Slc25a47 exhibits a highly liver-specific expression pattern, distinguishing it from many other members of the SLC25 family that show broader tissue distribution. Single-cell sequencing analysis and expression profiling have revealed that Slc25a47 is predominantly expressed in hepatocytes, making it a unique liver-specific transporter . RNA sequencing analysis of mouse liver tissues further demonstrated that Slc25a47 is among the most highly expressed SLC transporter genes in the liver, underscoring its importance in hepatic function .

At the subcellular level, Slc25a47 localizes specifically to mitochondria, where it is found in both the outer and inner mitochondrial membranes . This dual membrane localization suggests a specialized role in facilitating the transport of metabolites between the cytosol and mitochondrial matrix, potentially serving as a critical mediator of metabolic cross-talk between these compartments.

Role in Mitochondrial Homeostasis

The Slc25a47 protein plays a central role in maintaining mitochondrial homeostasis in hepatocytes. Research using liver-specific knockout models (Slc25a47 hep-/-) has demonstrated that loss of this transporter results in impaired mitochondrial respiration, leading to sustained energy deficiency in the liver . This mitochondrial dysfunction triggers a cascade of compensatory responses, including activation of the mitochondrial stress response (MSR) .

The impact of Slc25a47 on mitochondrial function appears to be multifaceted, affecting not only energy production but also the metabolic flexibility of liver cells. Without functional Slc25a47, hepatocytes demonstrate reduced capacity to adapt to changing energetic demands, highlighting the protein's role as a gatekeeper of mitochondrial metabolism . Recent evidence suggests that Slc25a47 may function as a mitochondrial NAD+ transporter, explaining its profound effects on mitochondrial energy production and metabolic regulation .

Liver-Specific Functions

Given its highly liver-specific expression pattern, Slc25a47 appears to have evolved specialized functions in hepatic metabolism. The loss of Slc25a47 in mouse liver leads to the development of fibrosis, which is exacerbated when animals are fed a high-fat high-sucrose diet . This observation points to a protective role of Slc25a47 against liver damage under metabolic stress conditions.

Additionally, Slc25a47 dysfunction triggers the hepatic secretion of several mitokines, signaling molecules that communicate mitochondrial stress to distant tissues . Among these, Fibroblast Growth Factor 21 (FGF21) plays a particularly important role in mediating systemic effects. Studies using double knockout models (Slc25a47-Fgf21 hep-/-) have demonstrated that many aspects of the hypermetabolic state observed in Slc25a47-deficient mice are driven by hepatic FGF21 secretion .

Metabolic Regulation

Beyond its role in liver metabolism, Slc25a47 influences whole-body metabolic homeostasis through its effects on hepatic function. The metabolic abnormalities observed in Slc25a47-deficient mice result from complex interactions between impaired hepatic mitochondrial function and compensatory systemic responses .

One of the most striking features of Slc25a47 hep-/- mice is their metabolic fuel inflexibility, which persists even when FGF21 signaling is genetically removed . This finding suggests that Slc25a47 plays a fundamental role in regulating substrate utilization in the liver, potentially by controlling the availability of specific metabolites to mitochondria through its transport function.

Recombinant Protein Production

Recombinant mouse Slc25a47 protein has been successfully produced using various expression systems, including cell-free expression methods and E. coli-based systems . These recombinant preparations provide valuable tools for investigating the structural and functional properties of the protein through biochemical and biophysical approaches.

Current commercial preparations typically achieve purity levels of 85% or greater as determined by SDS-PAGE analysis, making them suitable for applications such as enzyme-linked immunosorbent assay (ELISA), functional transport assays, and structural studies . Recombinant Slc25a47 proteins are available with various tags (e.g., His-tag) to facilitate purification and detection, expanding their utility in experimental settings .

Mouse Models and Their Findings

Genetically modified mouse models have proven instrumental in elucidating the physiological functions of Slc25a47. Key models developed for studying this protein include:

Mouse ModelDescriptionKey Findings
Slc25a47 hep-/-Liver-specific knockoutImpaired mitochondrial respiration, energy deficiency, activation of mitochondrial stress response, development of liver fibrosis
Slc25a47-Fgf21 hep-/-Double knockout of Slc25a47 and Fgf21 in liverRevealed FGF21-dependent and -independent effects of Slc25a47 deficiency; demonstrated persistent metabolic fuel inflexibility independent of FGF21
Slc25a47-KO with ob/ob backgroundSlc25a47 knockout on leptin-deficient backgroundExperimental model for studying interactions between Slc25a47 and metabolic dysregulation associated with obesity

These mouse models have been critical in establishing the importance of the Slc25a47 locus in mitochondrial homeostasis and identifying downstream consequences of its dysfunction, including both liver-specific pathologies and systemic metabolic alterations .

Role in Liver Disease

The identified role of Slc25a47 in hepatic fibrosis suggests potential clinical relevance in the context of liver diseases. Fibrosis represents a common pathway in various chronic liver conditions, including non-alcoholic fatty liver disease (NAFLD), non-alcoholic steatohepatitis (NASH), and viral hepatitis . The exacerbation of fibrosis in Slc25a47-deficient mice fed a high-fat high-sucrose diet points to a potential protective role of this transporter under conditions of metabolic stress that mirror human fatty liver disease .

Additionally, the original identification of SLC25A47 as a hepatocellular carcinoma down-regulated mitochondrial carrier protein (HDMCP) suggests a possible connection to liver cancer pathogenesis . Reduced expression in hepatocellular carcinoma may contribute to the metabolic reprogramming characteristic of cancer cells, though this connection requires further investigation.

Potential Therapeutic Applications

Given its central role in mitochondrial homeostasis and hepatic metabolism, the Slc25a47 locus represents a potential target for therapeutic intervention in liver diseases. Strategies aimed at enhancing Slc25a47 function or compensating for its deficiency might help mitigate mitochondrial dysfunction and reduce fibrosis in chronic liver conditions .

Furthermore, understanding the metabolites transported by Slc25a47 could lead to metabolic interventions that bypass the need for the transporter. Recent evidence suggesting that Slc25a47 functions as a mitochondrial NAD+ transporter opens possibilities for NAD+-based therapeutic approaches in conditions associated with Slc25a47 dysfunction .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a47; Hdmcp; Solute carrier family 25 member 47; Hepatocellular carcinoma down-regulated mitochondrial carrier homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a47
Target Protein Sequence
MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEAKYAGIWHCIRDTYRQERVWGFYRGLSLPV CTVSLVSSVSFGTYHHCLAHICRFRYGSTDAKPTKADITLSGCASGLVRVFLTSPTEVAK VRLQTQTQAQTQQRRSSASWTSGAPALCPTPTACLEPRPKYSGPLHCLVTVAREEGLRGL YKGSSALLLREGHSFATYFLSYAMLCEWLTPAGHSQPDVLGVLVAGGCAGVLAWAVATPM DVIKSRLQADGQGQHRYRGLLHCVVTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYEA VLRLTQSLLT
Uniprot No.

Target Background

Function

Uncoupling protein potentially catalyzing the physiological 'proton leak' in the liver.

Gene References Into Functions
  1. Elevated HDMCP expression was observed in a nonalcoholic steatohepatitis (NASH) animal model and in HFFA-72h cultured L02 cells. Downregulation of HDMCP, mediated by miR-146, alleviated NASH in both in vivo and in vitro studies, as evidenced by reduced steatosis and inflammation markers. PMID: 28346483
  2. Hepatocellular carcinoma down-regulated mitochondrial carrier protein is identified as a novel liver-specific uncoupling protein. PMID: 15322095
Database Links

KEGG: mmu:104910

UniGene: Mm.202653

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Slc25a47 and what makes it unique among SLC25 family members?

Slc25a47 (also known as AI132487, AI876593, and HDMCP) belongs to the SLC25 family of mitochondrial carrier proteins that transport metabolites across the inner mitochondrial membrane. Unlike other SLC25 family members that are ubiquitously expressed, Slc25a47 is exceptional for its selective expression in the liver . This tissue specificity makes Slc25a47 particularly interesting for liver-targeted therapeutic approaches.

The SLC25 family comprises 53 members in mammals, representing the largest family of mitochondrial inter-membrane metabolite carriers. Among these, Slc25a47 stands out as the sole member with liver-selective expression in both humans and mice . At the cellular level, hepatocytes are the primary cell type expressing Slc25a47, while Kupffer cells also express it at lower levels, accounting for approximately 10% of total Slc25a47 transcripts in the liver .

How is Slc25a47 structurally characterized?

Slc25a47, like other members of the SLC25 family, features a tripartite structure consisting of three repeats of approximately 100 amino acids each. The mouse Slc25a47 protein (as represented by NM_001012310) contains characteristic structural elements including:

  • Two transmembrane α-helices separated by hydrophilic loops in each repeat

  • A signature motif at the C terminus of the first helix in each repeat

  • A total protein length of 318 amino acids

The full-length mouse Slc25a47 protein sequence demonstrates the typical topological arrangement of mitochondrial carriers with six transmembrane domains and both N- and C-termini exposed to the cytosolic side of the inner mitochondrial membrane .

What methodologies are recommended for studying Slc25a47 expression patterns?

To effectively study Slc25a47 expression patterns, researchers should consider multiple complementary approaches:

  • RNA analysis: Quantitative PCR can be used to detect tissue-specific expression. Single-cell RNA-seq data reveals that hepatocytes are the primary cell type expressing Slc25a47, with some expression in Kupffer cells .

  • Protein detection: Western blotting using specific antibodies against Slc25a47 or tags (such as Myc-DDK) when using recombinant proteins .

  • Chromatin structure analysis: ATAC-seq data shows that the Slc25a47 gene locus (chromosome 12: 108,815,740-108,822,741 in mice) has an open chromatin architecture specific to the liver, while forming heterochromatin structures in other tissues like heart and lung .

  • Recombinant expression systems: Expression-ready ORF plasmids with C-terminal tags (such as those available from commercial sources) can be transfected into various cell lines using reagents like TurboFectin 8.0 .

What vectors and expression systems are suitable for recombinant Slc25a47 studies?

For effective recombinant expression of mouse Slc25a47:

Vector SystemFeaturesSelection MarkerApplications
pCMV6-EntryC-terminal Myc-DDK tagKanamycin (E. coli), Neomycin (mammalian)Mammalian cell expression, protein localization
pLenti-ORFLentiviral deliveryVariesStable cell line generation, in vivo studies
Liposome-based reconstitutionMembrane protein integrationN/ATransport activity studies, substrate identification

When selecting an expression system, consider the experimental goals: transient expression studies may use standard transfection methods, while stable expression or in vivo studies might require viral vectors. For functional characterization, reconstitution into liposomes allows for direct assessment of transport activities .

How does Slc25a47 regulate mitochondrial metabolism and hepatic gluconeogenesis?

Slc25a47 plays a critical role in regulating mitochondrial pyruvate flux and subsequent gluconeogenesis in the liver. Experimental evidence demonstrates that:

  • Pyruvate metabolism regulation: Depletion of Slc25a47 reduces mitochondrial pyruvate flux, thereby restricting lactate-derived hepatic gluconeogenesis and preventing hyperglycemia .

  • Metabolite alterations: Mitochondrial metabolomics analysis reveals that liver mitochondria of Slc25a47-depleted mice accumulate significantly higher levels of isocitrate, fumarate, and malate compared to controls, while mitochondrial phosphoenolpyruvate (PEP) contents are lower .

  • Mitochondrial carrier function: Slc25a47 appears to control either pyruvate import to the mitochondrial matrix or pyruvate flux within the mitochondria, similar to but distinct from mitochondrial pyruvate carrier (MPC) function .

To study these effects experimentally, researchers should implement isotope tracing methodologies coupled with mass spectrometry or NMR analysis. Positional isotopomer NMR tracer analysis is particularly recommended to determine how Slc25a47 loss alters rates of hepatic mitochondrial citrate synthase flux versus pyruvate carboxylase flux .

What are the recommended approaches for Slc25a47 loss-of-function studies?

Researchers can implement several strategies for Slc25a47 loss-of-function studies, each with distinct advantages:

  • Germline knockout models: Complete genetic deletion using Alb-Cre-mediated recombination has been used to study chronic effects of Slc25a47 absence .

  • Acute depletion using AAV-mediated Cre delivery: Administration of AAV-Cre to Slc25a47-floxed mice provides temporal control of depletion. This approach has demonstrated that acute SLC25A47 depletion by approximately 50% sufficiently restricts gluconeogenesis and enhances insulin tolerance without causing liver fibrosis or mitochondrial dysfunction .

  • Partial inhibition approaches: Data suggest that partial inhibition (rather than complete deletion) may be advantageous to avoid detrimental side effects while maintaining the beneficial metabolic effects .

When designing loss-of-function studies, researchers should consider that:

  • Acute versus chronic depletion produces different phenotypes

  • The degree of depletion (partial vs. complete) significantly affects outcomes

  • Appropriate controls (including AAV-GFP injections) are essential

  • Metabolic phenotyping should include pyruvate tolerance tests, insulin tolerance tests, and glycerol tolerance tests

How can researchers reconcile contradictory findings about Slc25a47 function in metabolic health?

The literature contains apparently inconsistent reports regarding Slc25a47's role in metabolic health that researchers must carefully navigate . To reconcile these contradictions:

  • Consider genetic background effects: Different mouse strains may show variable phenotypes following Slc25a47 manipulation.

  • Distinguish acute versus chronic effects: Chronic SLC25A47 deletion can lead to mitochondrial stress, lipid accumulation, and fibrosis, while acute partial depletion may provide metabolic benefits without these adverse effects .

  • Analyze degree of depletion: Complete knockout versus partial knockdown may produce opposite phenotypes. Research suggests that approximately 50% reduction may be optimal for metabolic benefits without liver damage .

  • Implement comprehensive phenotyping: Assess multiple parameters including:

    • Gluconeogenic capacity (pyruvate tolerance tests)

    • Insulin sensitivity (insulin tolerance tests)

    • Energy expenditure (indirect calorimetry)

    • Mitochondrial function (respiration measurements, metabolomics)

    • Liver health markers (fibrosis staining, AST/ALT levels)

  • Examine FGF21 signaling: Elevated energy expenditure and reduced body weight in Slc25a47-depleted mice appears to be attributed to elevated FGF21 production. Recent work demonstrated that deletion of FGF21 abrogated the effects of SLC25A47 on energy expenditure and body weight .

What methodological approaches are recommended for studying Slc25a47 transport function?

To characterize Slc25a47 transport function, researchers can employ several complementary approaches:

  • Liposome reconstitution assays: Purified recombinant Slc25a47 can be reconstituted into liposomes to directly measure transport activities for various substrates in homo-exchange experiments, similar to methods used for other SLC25 family members .

  • Isolated mitochondria studies: Prepare intact mitochondria from Slc25a47-expressing and control tissues to assess substrate transport across the inner mitochondrial membrane.

  • Metabolite tracing experiments: Use isotope-labeled substrates (e.g., 13C-pyruvate, 13C-lactate) to track metabolic flux through pathways potentially affected by Slc25a47.

  • Mitochondrial metabolomics: Compare the mitochondrial metabolite profile between wild-type and Slc25a47-deficient samples. Previous studies have shown significant differences in TCA cycle intermediates, particularly isocitrate, fumarate, and malate .

For transport studies, researchers should consider preparing the following experimental tools:

Experimental SystemApplicationKey Controls
Purified recombinant proteinDirect transport assaysHeat-inactivated protein, non-transporting mutants
Isolated mitochondriaPhysiological contextRespiratory chain inhibitors to prevent metabolism of transported substrates
Cellular modelsIntegrated system studiesSpecific inhibitors of other transporters/metabolic enzymes

What is the significance of Slc25a47 in human metabolic disease research?

Slc25a47 represents a promising target for human metabolic disease research, particularly for hyperglycemia and type 2 diabetes, for several reasons:

  • Genetic associations: Genome-wide association studies (GWAS) have found significant associations between SLC25A47 and glycemic homeostasis in humans. Several SNPs in the SLC25A47 gene were significantly associated with lower levels of glucose and HbA1c adjusted for BMI, though the functional consequences of these SNPs require further investigation .

  • Liver specificity: Unlike most other mitochondrial carriers that are ubiquitously expressed, SLC25A47's selective expression in the liver makes it an attractive therapeutic target with potentially fewer off-target effects .

  • Gluconeogenic regulation: Excess hepatic gluconeogenesis is commonly observed in human hyperglycemia and type 2 diabetes. SLC25A47 manipulation offers a liver-specific approach to restricting this process .

  • Therapeutic potential: Temporal and partial inhibition of SLC25A47 using small-molecule inhibitors or antisense oligonucleotides could effectively restrict excess hepatic gluconeogenesis while avoiding detrimental side effects associated with complete deletion .

Research approaches for investigating Slc25a47 in human metabolism should include:

  • Human tissue expression analysis across metabolic disease states

  • Genetic association studies correlating SLC25A47 variants with metabolic parameters

  • Development of cell-based models using human hepatocytes to validate findings from mouse studies

  • Exploration of liver-targeting drug delivery systems for potential SLC25A47 modulators

How should researchers design pyruvate flux experiments to assess Slc25a47 function?

To effectively evaluate Slc25a47's role in pyruvate metabolism, consider the following experimental approach:

  • Isolated mitochondria studies: Prepare mitochondria from Slc25a47-expressing and control livers, then measure:

    • Pyruvate uptake using radiolabeled pyruvate

    • Pyruvate-driven respiration rates

    • Pyruvate carboxylation to oxaloacetate

    • Pyruvate dehydrogenation to acetyl-CoA

  • Metabolic flux analysis: Use stable isotope-labeled substrates (13C-pyruvate) to trace metabolic fates in control versus Slc25a47-deficient systems:

    • Measure 13C enrichment in TCA cycle intermediates

    • Quantify incorporation into gluconeogenic precursors

    • Assess relative flux through pyruvate carboxylase versus pyruvate dehydrogenase pathways

  • In vivo assessment: Implement pyruvate tolerance tests in mice with varying Slc25a47 expression levels to measure whole-body pyruvate handling capacity .

These experiments should be performed under both fed and fasted conditions, as the impact of Slc25a47 on pyruvate metabolism is particularly pronounced during fasting when gluconeogenesis is activated .

What controls are essential when analyzing the effects of Slc25a47 genetic manipulation?

When designing studies involving Slc25a47 genetic manipulation, researchers should implement the following controls:

  • Cre-only controls: When using Cre-lox systems, include cohorts expressing Cre recombinase without floxed Slc25a47 to control for Cre-mediated effects.

  • Appropriate vector controls: For AAV-mediated modifications, use AAV-GFP or empty vector controls administered using identical procedures.

  • Liver damage assessment: Monitor liver health markers to distinguish direct metabolic effects from secondary consequences of hepatic injury:

    • Histological analyses (H&E staining, Picro-Sirius Red for fibrosis)

    • Serum markers (AST, ALT)

    • Expression of liver fibrosis marker genes

    • Mitochondrial function assays (Complex I and II activities)

  • Rescue experiments: Include genetic rescue by reintroducing Slc25a47 into knockout models to confirm that observed phenotypes are directly attributable to Slc25a47 loss rather than compensatory mechanisms .

  • Time-course studies: Examine both acute and chronic effects of Slc25a47 manipulation, as these can differ significantly in terms of metabolic outcomes and potential liver damage .

How can researchers effectively study the relationship between Slc25a47 and FGF21 signaling?

To investigate the relationship between Slc25a47 and FGF21 signaling:

  • Expression correlation analysis:

    • Measure hepatic FGF21 mRNA expression and serum FGF21 protein levels following Slc25a47 manipulation

    • Perform time-course studies to determine whether FGF21 changes are immediate or delayed responses

  • Mechanistic studies:

    • Implement FGF21 knockout or neutralization in Slc25a47-deficient models to determine which phenotypic effects are FGF21-dependent

    • Investigate whether mitochondrion-derived metabolites (such as malate) control FGF21 transcription via retrograde signaling

  • Systemic effects assessment:

    • Evaluate energy expenditure through indirect calorimetry

    • Measure body weight changes and adipose tissue metabolism

    • Assess glucose homeostasis parameters including insulin sensitivity

  • Control experiments:

    • Rule out liver damage as the cause of FGF21 induction by correlating serum AST levels with FGF21 levels

    • Examine direct FGF21 administration effects compared to Slc25a47 manipulation

Research has demonstrated that elevated energy expenditure and reduced body weight in Slc25a47-deficient mice appears to be attributed to elevated FGF21, as deletion of FGF21 abrogated these effects of SLC25A47 depletion .

What are the most promising therapeutic applications of Slc25a47 research?

The unique characteristics of Slc25a47 position it as a promising therapeutic target for several metabolic conditions:

  • Type 2 diabetes and hyperglycemia: Targeting Slc25a47 could restrict excess hepatic gluconeogenesis, which is commonly observed in diabetic conditions. Genome-wide association studies have found significant associations between SLC25A47 SNPs and lower glucose and HbA1c levels .

  • Metabolic syndrome: The dual effects of Slc25a47 manipulation on both gluconeogenesis and energy expenditure (via FGF21 induction) suggest potential benefits for broader metabolic syndrome features .

  • Liver-specific intervention: Unlike most mitochondrial carriers that are ubiquitously expressed, Slc25a47's liver-specific expression offers targeted metabolic intervention with potentially fewer systemic side effects .

The most promising therapeutic approaches include:

  • Partial inhibition strategies (approximately 50% reduction) rather than complete knockout

  • Temporal intervention using inducible systems or short-acting compounds

  • Liver-targeted delivery systems similar to those developed for mitochondrial uncouplers that have shown protection against diabetes and cardiovascular complications

How should researchers integrate genetic and physiological data when studying Slc25a47?

To effectively integrate genetic and physiological data in Slc25a47 research:

  • Correlate genotype with metabolic phenotypes:

    • Analyze the effects of human SLC25A47 SNPs on glycemic parameters and energy metabolism

    • Develop mouse models harboring equivalent human variants to validate functional effects

  • Connect gene expression levels with metabolic outcomes:

    • Quantify Slc25a47 expression across different nutritional states (fed, fasted, various diets)

    • Correlate expression levels with metabolic parameters in both mouse models and human samples

  • Implement multi-omics approaches:

    • Combine transcriptomics, proteomics, and metabolomics data from Slc25a47 manipulation models

    • Identify key nodes in regulatory networks affected by Slc25a47 function

  • Consider tissue-specific effects:

    • Focus on liver-specific consequences while monitoring systemic metabolic adaptations

    • Examine cross-talk between liver and other metabolic tissues following Slc25a47 manipulation

  • Develop translational biomarkers:

    • Identify metabolite signatures in accessible biofluids that reflect Slc25a47 activity

    • Correlate these signatures with disease progression or therapeutic responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.