Recombinant Mouse Solute carrier family 25 member 48 (Slc25a48)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Mouse Slc25a48 refers to the genetically engineered form of the mouse mitochondrial carrier protein expressed in heterologous systems like E. coli or HEK293 cells . Key features include:

  • UniProt ID: Q8BW66

  • Length: 306 amino acids (full-length)

  • Tags: Typically fused with His, Fc, or Avi tags for purification and detection

Mitochondrial Choline Transport

Slc25a48 facilitates choline import into mitochondria, enabling betaine synthesis and one-carbon metabolism . Key findings:

  • Knockout Effects:

    • Reduced mitochondrial respiration (Complex I/II activity)

    • Impaired purine nucleotide synthesis (guanine, hypoxanthine)

    • Cell cycle arrest at G1/S phase in cancer cells

Thermogenesis Regulation

  • Essential for brown adipose tissue (BAT) function during cold tolerance .

  • Loss causes defective thermogenesis and mitochondrial membrane instability .

Table 1: Key Studies Involving Recombinant Slc25a48

Study FocusModel SystemMajor FindingsCitation
Choline transport mechanismBAT-derived cellsSLC25A48 mediates mitochondrial choline uptake
Cancer metabolismOvarian/lung cancerSlc25a48 loss induces cell death via purine depletion
Protein localizationMitochondrial assaysConfirmed inner mitochondrial membrane localization

Stability and Handling

  • Lyophilized Form: Reconstitute in sterile water (0.1–1.0 mg/mL) .

  • Storage: -80°C with 50% glycerol; avoid freeze-thaw cycles .

Implications for Disease Research

  • Cancer: Slc25a48 supports nucleotide synthesis in SKOV3 (ovarian) and A549 (lung) cancer lines; knockout reduces viability .

  • Metabolic Disorders: Linked to mitochondrial lipid imbalance and ROS overproduction in KO models .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is recommended. To avoid degradation, minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Slc25a48; Solute carrier family 25 member 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Slc25a48
Target Protein Sequence
MGSFQLEDFVAGWIGGVASVIVGYPLDTVKTRLQAGVGYANTFNCIRMVYKRERVFGFFK GMSFPLASIAIYNSVVFGVFSNTQRFLSKYRCGELEAGPGRSLSDLLLASMLTGVVSVGL GGPVELIKIRLQMQTQPFREASHGLKSRAVAAYQGPVHCIATIVQMEGLTGLYRGASAML LRDIPGYCFYFIPYVFLSEWITPEACTGPSPYAAWLAGGIAGAISWGTATPMDVVKSRIQ ADGVYLNKYRGVVDCISQSYQQEGFKVFFRGITVNAVRGFPMSAAMFLGYELSLKALRGE HTVRSE
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Slc25a48 and what is its primary function?

Slc25a48 is a mitochondrial inner-membrane protein that controls mitochondrial choline transport and catabolism in vivo. It functions as a critical component of the mitochondrial carrier family, facilitating the import of choline into the mitochondrial matrix. This transport activity enables betaine synthesis and supports one-carbon metabolism. Importantly, the choline uptake via Slc25a48 plays a vital role in facilitating purine nucleotide synthesis, which is essential for cell cycle progression and cell survival . Unlike other mitochondrial carriers, Slc25a48 has a specific role in choline metabolism that connects mitochondrial function to nucleotide synthesis pathways.

Where is Slc25a48 predominantly expressed in mice?

Slc25a48 is highly expressed in brown adipose tissue (BAT) in mice. Research demonstrates that Slc25a48 expression is rapidly induced during brown adipocyte differentiation, suggesting a specific functional role in these cells . This expression pattern distinguishes Slc25a48 from other mitochondrial carrier proteins, such as SLC25A4, which maintains constant expression levels during brown adipogenesis . The high expression in BAT correlates with its functional importance in thermogenesis and mitochondrial respiration in this tissue type.

What is the subcellular localization of Slc25a48?

Slc25a48 specifically localizes to the inner mitochondrial membrane (IMM). This localization has been confirmed through proteinase degradation assays in isolated mitochondria. In experiments with brown adipocytes expressing SLC25A48 with a Flag-tag, researchers demonstrated that Slc25a48 was present in the mitochondrial fraction and was not degraded by proteinase K treatment . This protection from degradation occurred under conditions where the outer mitochondrial membrane marker TOMM20 was degraded but the IMM marker ATP5A remained intact, providing strong evidence for Slc25a48's IMM localization. This is significant because it distinguishes Slc25a48 from other SLC25A family members that localize to different cellular compartments, such as SLC25A17 (peroxisome) and SLC25A46/SLC25A50 (outer mitochondrial membrane) .

How can researchers generate Slc25a48-knockout models for functional studies?

To generate Slc25a48-knockout models, researchers can obtain germline knockout mice from the Knockout Mouse Phenotyping Program (KOMP) at Jackson Laboratory (Strain# 051066-JAX). Based on published protocols, these mice can be backcrossed to wild-type mice (Jackson Laboratory, Strain# 000664) to establish the genetic background . For breeding experiments, heterozygous knockout mice should be crossed to generate littermate controls and homozygous knockout mice. The knockout targeting typically focuses on exon 4, which encodes two of the six transmembrane domains of Slc25a48 .

For cellular models, CRISPR/Cas9 technology can be employed using commercially available plasmids (e.g., Santa Cruz Biotechnology; sc-418922, sc-414730, sc-414730-HDR) transfected with appropriate reagents. Cell lines with stable knockout can be established through antibiotic selection or cell sorting methods .

What methods are effective for studying Slc25a48 function in cellular systems?

For cellular studies of Slc25a48 function, researchers should consider these approaches:

  • Rescue experiments: Generate knockout cell lines followed by reintroduction of codon-optimized Slc25a48 cDNA. This approach allows direct comparison between knockout and rescued cells from identical origins, eliminating concerns about cellular composition differences .

  • Mitochondrial isolation: Differential centrifugation to enrich mitochondrial fractions, followed by proteinase K treatment to distinguish inner and outer mitochondrial membrane proteins .

  • Respiration assays: Measure cellular respiration using instruments that determine oxygen consumption rate (OCR) and extracellular acidification rate (ECAR), particularly with stimulation by norepinephrine in brown adipocytes .

  • MITO-Tag techniques: Employ constructs such as pMXs-3XHA-EGFP-OMP25 for mitochondrial tagging experiments, followed by cell sorting for equally low abundant EGFP-positive cells .

  • Cell cycle analysis: Utilize EdU incorporation assays (Click-iT Plus EdU Flow Cytometry Assay Kit) combined with DNA content measurement (FxCycle Violet Ready Flow Reagent) and analyze via flow cytometry using appropriate software (FlowJo, CytExpert) .

What are the critical parameters for assessing Slc25a48-related phenotypes in vivo?

When assessing Slc25a48-related phenotypes in vivo, researchers should focus on:

These measurements should be conducted in both male and female mice to identify potential sex-specific differences in phenotypes.

How does Slc25a48 affect mitochondrial respiratory capacity?

Slc25a48 significantly impacts mitochondrial respiratory capacity through several mechanisms:

ParameterSlc25a48-KO EffectMechanistic Implication
Complex I & II respirationSignificantly attenuatedImpaired electron transport chain function
Maximum respiratory capacity (FCCP-induced)Significantly lowerReduced mitochondrial energy production potential
UCP1-mediated thermogenesisAttenuatedImpaired heat generation in BAT
Mitochondrial cristaeLess dense ultrastructureAltered internal membrane organization
NAD and NADPH levelsSignificantly reducedCompromised redox balance and metabolic cofactor availability

Importantly, the respiratory impairment occurs without changes in mitochondrial protein abundance. Both UCP1 and OXPHOS proteins show similar expression levels between Slc25a48-KO and control animals . This indicates that Slc25a48 affects respiratory function rather than mitochondrial biogenesis or protein expression. The effect appears to be mediated through alterations in metabolic substrates and cofactors that support respiratory chain function.

What is the relationship between Slc25a48 and choline metabolism?

Slc25a48 serves as a critical mitochondrial choline transporter that regulates several downstream metabolic pathways:

  • Betaine synthesis: Slc25a48-mediated choline import into mitochondria facilitates the synthesis of betaine, an important methyl donor .

  • One-carbon metabolism: Through its impact on betaine availability, Slc25a48 supports one-carbon metabolic reactions essential for biosynthetic processes .

  • Purine nucleotide synthesis: Cells lacking Slc25a48 exhibit reduced synthesis of purine nucleotides, linking choline metabolism to nucleotide biosynthesis .

  • NAD/NADPH levels: Mitochondrial contents of nicotinamide adenine dinucleotide (NAD) and nicotinamide adenine dinucleotide phosphate (NADPH) are significantly lower in Slc25a48-KO cells compared to rescued cells .

This metabolic nexus positions Slc25a48 as a regulatory link between mitochondrial choline import and critical cellular biosynthetic and energetic pathways, particularly affecting purine metabolism more specifically than pyrimidine metabolism, as evidenced by unaltered cytidine diphosphate (CDP) levels .

How does Slc25a48 contribute to thermogenesis in brown adipose tissue?

Slc25a48 plays a crucial role in brown adipose tissue thermogenesis through several mechanisms:

Interestingly, this thermogenic impairment occurs despite normal UCP1 protein levels, suggesting that Slc25a48 affects the metabolic substrates or cofactors required for UCP1-mediated thermogenesis rather than UCP1 expression itself .

How does Slc25a48 deficiency affect cell cycle progression?

Slc25a48 deficiency significantly impairs cell cycle progression, particularly affecting the G1-to-S phase transition. When Slc25a48 function is lost, cells fail to properly initiate the transition from G1 to S phase, leading to cell cycle arrest and ultimately cell death . This impact on cell cycle appears to be linked to Slc25a48's role in facilitating purine nucleotide synthesis, which is essential for DNA replication during S phase. The cell cycle disruption represents a direct mechanistic link between mitochondrial choline metabolism and nuclear cell cycle control, highlighting the critical role of Slc25a48 in coordinating these cellular processes.

What methods are appropriate for assessing the impact of Slc25a48 on cell viability?

To assess the impact of Slc25a48 on cell viability, researchers should employ multiple complementary approaches:

  • MTS assay: The MTS assay provides a quantitative method to determine cell proliferation and viability. Cells should be counted and equally plated in 96-well plates. For proliferation studies, results should be normalized to time 0 (24 hours post-seeding). For viability assessment, measurements should be taken 24 hours post-induction of Slc25a48 knockout .

  • Cell cycle analysis: EdU incorporation combined with DNA content analysis is effective for examining cell cycle progression. Researchers should incubate cells with EdU (10 μM) for 1 hour in appropriate media 16 hours post-transfection, then fix cells according to manufacturer's instructions. DNA content can be measured using FxCycle Violet Ready Flow Reagent, and cells analyzed by flow cytometry (e.g., FACS Aria II with 100 mm nozzle) .

  • Proliferation kinetics: Tracking cell numbers over time (e.g., 24, 48, 72 hours) provides dynamic information about proliferation rates and potential growth arrest points in Slc25a48-deficient cells compared to controls.

  • Metabolite rescue experiments: Supplementing media with metabolites downstream of the Slc25a48-dependent pathway (e.g., purine nucleotides) can help determine if viability defects are direct consequences of specific metabolic deficiencies.

What is the relationship between Slc25a48, purine nucleotide synthesis, and cancer cell metabolism?

Slc25a48 plays a critical role in cancer cell metabolism through its regulation of purine nucleotide pools:

  • Cell cycle progression: Slc25a48-mediated choline import is required for cancer cell cycle progression, likely through mitochondria-dependent regulation of purine nucleotide synthesis .

  • Metabolic dependency: Cancer cells may exhibit increased dependency on Slc25a48 function due to their elevated requirements for nucleotide synthesis to support rapid proliferation.

  • One-carbon metabolism: By facilitating betaine synthesis and supporting one-carbon metabolism, Slc25a48 contributes to the metabolic network that cancer cells leverage for growth advantage.

  • Selective nucleotide effects: The impact of Slc25a48 deficiency appears selective for purine nucleotides, as pyrimidine metabolites like cytidine diphosphate (CDP) remain unchanged , suggesting a specific metabolic vulnerability that could be exploited in cancer research.

This relationship positions Slc25a48 as a potential metabolic target in cancer research, particularly for cancers that show dependency on mitochondrial choline metabolism or heightened requirements for purine nucleotide synthesis.

What are the essential controls for Slc25a48 knockout studies?

When conducting Slc25a48 knockout studies, researchers should implement these essential controls:

  • Littermate wild-type controls: For in vivo studies, heterozygous Slc25a48 knockout mice should be crossed to generate littermate controls with identical genetic backgrounds except for the Slc25a48 allele .

  • Rescued cell lines: For cellular studies, reintroduction of a codon-optimized human SLC25A48-Flag cDNA into Slc25a48-KO cells creates an ideal control system from identical cell origins .

  • Heterozygous models: Including heterozygous Slc25a48 knockouts can provide insights into gene dosage effects and potential compensatory mechanisms.

  • Empty vector controls: When reintroducing Slc25a48 into knockout cells, appropriate empty vector controls should be included to account for effects of the expression system.

  • Sex-matched comparisons: Both male and female mice should be studied separately, as shown by the varying effects of Slc25a48 knockout between sexes for certain parameters .

  • Experimental timing controls: For thermogenesis studies, proper acclimation periods (e.g., 10 days at 30°C before cold exposure) are essential to standardize adaptive responses .

What molecular biology techniques are most effective for studying Slc25a48?

The most effective molecular biology techniques for studying Slc25a48 include:

  • CRISPR/Cas9 gene editing: For generating knockout cell lines using commercially available plasmids (e.g., Santa Cruz Biotechnology; sc-418922, sc-414730, sc-414730-HDR) with appropriate transfection reagents .

  • Retroviral/lentiviral expression systems: For stable expression of Slc25a48 constructs, using packaging constructs and calcium phosphate transfection methods in HEK293T cells, followed by viral supernatant collection, filtration, and infection of target cells with polybrene supplementation .

  • Subcellular fractionation: Differential centrifugation to isolate mitochondria, combined with proteinase K treatment to distinguish proteins of the inner versus outer mitochondrial membrane .

  • Western blotting: For assessing protein expression levels of Slc25a48 and related mitochondrial proteins (UCP1, OXPHOS components) .

  • Electron microscopy: For examining mitochondrial ultrastructure and cristae density in tissues from Slc25a48-KO versus control animals .

  • Metabolic phenotyping: Combining respirometry, metabolomics, and cell cycle analysis to comprehensively characterize the functional consequences of Slc25a48 manipulation .

What are the limitations of current methods for studying Slc25a48 function?

Current methods for studying Slc25a48 function have several important limitations:

  • Tissue specificity challenges: While Slc25a48 is highly expressed in brown adipose tissue, its roles in other tissues with lower expression remain underexplored and may require more sensitive detection methods.

  • Temporal dynamics: Many current methods provide snapshots of Slc25a48 function rather than capturing dynamic changes over time or in response to various physiological stimuli.

  • Direct transport measurement: Current studies infer Slc25a48's role in choline transport indirectly through metabolic consequences rather than directly measuring transport kinetics in isolated mitochondria.

  • Compensatory mechanisms: Conventional knockout models may trigger compensatory upregulation of other transporters or metabolic pathways, potentially masking the full impact of Slc25a48 deficiency.

  • Integration with other metabolic pathways: The complex interconnections between choline metabolism, one-carbon metabolism, and nucleotide synthesis make it challenging to isolate the specific contributions of Slc25a48 to each pathway.

  • Translational relevance: The relationship between mouse Slc25a48 function and human SLC25A48 requires further investigation to establish relevant disease models and therapeutic implications.

Researchers should consider these limitations when designing experiments and interpreting results from Slc25a48 studies, potentially developing new methodologies to address these gaps.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.