Recombinant Mouse Somatostatin receptor type 1 (Sstr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Sstr1; Smstr1; Somatostatin receptor type 1; SS-1-R; SS1-R; SS1R; SRIF-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MFPNGTASSPSSSPSPSPGSCGEGACSRGPGSGAADGMEEPGRNASQNGTLSEGQGSAIL ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS RAYSVEDFQPENLESGGVFRNGTCASRISTL
Uniprot No.

Target Background

Function
Somatostatin receptor type 1 (Sstr1) is a receptor for somatostatin, exhibiting higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin-sensitive G proteins to the inhibition of adenylyl cyclase. Additionally, it stimulates phosphotyrosine phosphatase and Na(+)/H(+) exchanger through pertussis toxin-insensitive G proteins.
Gene References Into Functions
  1. This study demonstrated that reduced expression of Sstr1 modulates antidepressant action in the hippocampus. PMID: 25784603
  2. The expression and localization of the three receptors (SSTR3-SSTR5) in wild-type (WT), single-knockout (SSTR1 KO) and double-knockout SSTR1/SSTR2 (DKO) mice are reported. PMID: 25149275
  3. SSTR1 was expressed in Kolliker's organ on E14, on cochlear duct hair cells & supporting cells on E17, and only on the organ of Corti at birth. Expression increases and peaks at P14 before declining at P21. PMID: 22986312
  4. SSTR1-like immunoreactivity increases in the hypothalamus, except in the paraventricular nucleus of ApoD(-/-) mice. PMID: 22581439
  5. SST and SSTRs might play a significant role in the regulation of neurodegeneration. PMID: 21912697
  6. Data suggest an important role for the brain somatostatin receptor 1 subtype in modulating the gastrointestinal response to activation of brain CRF pathways. PMID: 21564422
  7. The effect of sst2 receptor knockout on sst1 receptor mRNA localization and binding sites throughout the brain has been determined. PMID: 11897118
  8. The localization of somatostatin to retinal amacrine cells, along with the expression of somatostatin receptors in amacrine, bipolar and horizontal cells suggests that somatostatin acts at multiple levels of retinal circuitry. PMID: 11988224
  9. sst1 receptor loss causes a significant increase in retinal levels of somatostatin-14 (SRIF) while not affecting SRIF messenger RNA, indicating that sst1 receptors play a role in limiting retinal SRIF at the post-transcriptional level. PMID: 14614951
  10. Somatostatin receptors 1 and 2 are expressed in the adult mouse kidney. PMID: 15093692
  11. SSTR1 plays a crucial role in the regulation of insulin secretion in the endocrine pancreas in mice. PMID: 16406265
  12. SSTR1 activation can inhibit insulin secretion in pancreatic beta-cells. PMID: 18845633
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Jejunum and stomach.

Q&A

What is Somatostatin Receptor Type 1 and what is its basic structure?

Somatostatin Receptor Type 1 (Sstr1) belongs to a family of five G-protein-coupled receptors (Sstr1-5) that mediate the biological effects of somatostatin. Structurally, Sstr1 is characterized by seven transmembrane helices with an extracellular amino terminal domain and an intracellular carboxy terminus . This receptor is predominantly located in the cell membrane and functions through coupling with G-proteins . The receptor has a higher binding affinity for somatostatin-14 compared to somatostatin-28, which influences its physiological activity and response to endogenous ligands .

For recombinant expression, it's important to note that the full-length mouse Sstr1 comprises 391 amino acids, with the immunogen region typically derived from amino acids 201-300 when developing antibodies against this receptor . The receptor's extracellular domains are particularly important for ligand recognition and have been used successfully for generating monoclonal antibodies with high specificity .

How does Sstr1 differ from other somatostatin receptor subtypes?

While all five somatostatin receptor subtypes share structural similarities as G-protein coupled receptors, Sstr1 possesses unique pharmacological and signaling properties. The receptor has distinctive ligand binding characteristics, with higher affinity for somatostatin-14 than somatostatin-28 . Unlike some other subtypes that have been extensively targeted with synthetic analogues, Sstr1 has only recently been characterized with subtype-selective agonists such as L-797591 .

At the molecular level, Sstr1 signaling occurs through coupling with pertussis toxin-sensitive G proteins that inhibit adenylyl cyclase. Additionally, Sstr1 can stimulate phosphotyrosine phosphatase and Na+/H+ exchanger via pertussis toxin-insensitive G proteins, representing a distinct signaling pathway . Recent cryoelectron microscopy studies have further revealed unique structural features of the Sstr1 orthosteric binding pocket compared to other subtypes, which explains the selectivity of certain ligands .

What antibodies and detection methods are available for mouse Sstr1 studies?

Several validated antibodies are available for mouse Sstr1 research, including both monoclonal and polyclonal options. Monoclonal antibodies against Sstr1 have been developed using peptides corresponding to the extracellular domain of Sstr1 conjugated to keyhole limpet hemocyanin (KLH) . These antibodies have been validated for multiple applications, including:

  • Immunohistochemistry (IHC)

  • Immunocytochemistry (ICC)

  • Flow cytometry

  • Western blotting (WB)

  • Enzyme-linked immunosorbent assay (ELISA)

For optimal results in Western blotting applications, antibody dilutions ranging from 1:300 to 1:5000 are recommended, while ELISA applications typically use dilutions of 1:500 to 1:1000 . When selecting an antibody, researchers should consider species cross-reactivity - some anti-Sstr1 antibodies recognize the receptor in multiple species including human, mouse, and rat, which can be advantageous for comparative studies .

Storage conditions for these antibodies typically involve shipping at 4°C and long-term storage at -20°C for up to one year, with recommendations to avoid repeated freeze/thaw cycles to maintain antibody integrity .

What expression systems are most effective for producing recombinant mouse Sstr1?

For structural and functional studies requiring purified recombinant Sstr1, mammalian expression systems are generally preferred due to the complex post-translational modifications and membrane insertion requirements of this GPCR. Recent cryoelectron microscopy studies of Sstr1 have successfully utilized expression systems that enable proper folding and trafficking of the receptor to the plasma membrane .

When designing expression constructs, consideration should be given to:

  • Addition of affinity tags (such as His or FLAG) for purification

  • Incorporation of thermostabilizing mutations if needed for structural studies

  • Fusion with stabilizing partners (such as T4 lysozyme or BRIL) for crystallography approaches

  • Codon optimization for the selected expression system

For functional studies, HEK293 and CHO cell lines have been successfully used to express recombinant mouse Sstr1, allowing for pharmacological characterization and signaling assays. For large-scale protein production aimed at structural biology applications, insect cell systems (Sf9, Sf21) with baculovirus vectors have proven effective for other GPCRs and may be applicable to Sstr1 .

How does Sstr1 influence insulin secretion and glucose metabolism?

Sstr1 plays a significant role in regulating insulin secretion and glucose homeostasis, as evidenced by studies using Sstr1 knockout models. SSTR1 is expressed on the majority of human pancreatic beta cells, indicating its importance in pancreatic function . Experimental evidence from isolated pancreata perfusion demonstrates that Sstr1 knockout mice exhibit significantly increased insulin secretion compared to wild-type controls, suggesting that Sstr1 normally functions to suppress insulin release .

The relationship between Sstr1 and glucose metabolism appears to be age-dependent. At 3 months of age, Sstr1-/- mice display decreased systemic insulin secretion and glucose intolerance despite increased insulin release in isolated pancreata . This apparent contradiction can be explained by the finding that Sstr1 knockout mice have a higher rate of insulin clearance compared to wild-type animals. In contrast, by 12 months of age, these same knockout mice develop increased glucose tolerance with exaggerated insulin levels, indicating a complex age-related shift in metabolic regulation .

These temporal changes suggest that Sstr1 signaling influences not only direct insulin secretion but also participates in adaptive responses in glucose metabolism over time, potentially through interactions with other somatostatin receptor subtypes or compensatory mechanisms.

What pancreatic islet cell changes occur in Sstr1 knockout models?

Immunochemical analysis of pancreatic islets from Sstr1 knockout mice has revealed significant alterations in islet composition and receptor expression. Most notably, Sstr1-/- mice show:

  • Significantly decreased somatostatin staining in pancreatic islets

  • Significant reduction in SSTR5 expression

These findings indicate that Sstr1 ablation affects not only its direct signaling pathways but also influences the expression of other components of the somatostatin signaling system within pancreatic islets. The reduced somatostatin staining suggests alterations in delta cell function or number, which could contribute to the observed changes in insulin secretion and glucose homeostasis.

The downregulation of SSTR5 in Sstr1 knockout mice is particularly interesting as it suggests potential compensatory mechanisms or crosstalk between different somatostatin receptor subtypes. This observation highlights the complexity of somatostatin signaling in pancreatic islets and underscores the importance of considering receptor interactions when studying the physiological roles of individual subtypes .

What recent structural findings inform our understanding of Sstr1 ligand binding?

Recent cryoelectron microscopy (cryo-EM) studies have provided groundbreaking insights into the structural basis of ligand recognition by Sstr1. These studies have revealed the detailed architecture of Sstr1 bound to both panagonists like pasireotide and subtype-selective agonists such as L-797591 . The structural data demonstrates that Sstr1 possesses a conserved extended binding pocket that accommodates pasireotide in a manner distinct from how it interacts with other ligands like SST14, octreotide, and lanreotide .

The orthosteric binding pocket of Sstr1 shows dynamic features that allow it to accommodate different ligands, with specific residues controlling ligand selectivity across SSTR subtypes . Mutagenesis analyses combined with structural data have identified key determinants within the binding pocket that are critical for ligand recognition. These findings explain the molecular basis for the selectivity of compounds like L-797591 for Sstr1 over other SSTR subtypes .

Particularly important for ligand binding are residues Q6.55 and S7.34, which have been demonstrated to play crucial roles in determining the biological activity of Sstr1 ligands . Other residues consistently involved in hydrophobic interactions with Sstr1 antagonists have also been identified, contributing to our understanding of how diverse ligands engage with this receptor .

How do selective Sstr1 agonists differ from panagonists in their binding mechanisms?

The binding mechanisms of selective Sstr1 agonists differ significantly from those of panagonists, as revealed by recent structural studies . Panagonists like pasireotide interact with a conserved extended binding pocket in Sstr1, which explains their ability to activate multiple somatostatin receptor subtypes. This binding pattern is distinct from that observed with other common SSTR ligands such as SST14, octreotide, and lanreotide .

In contrast, subtype-selective agonists like L-797591 exploit unique structural features in the Sstr1 binding pocket that are not conserved across other SSTR subtypes . These selective compounds engage with specific residues that differ between receptor subtypes, allowing them to discriminate between closely related receptors. The identification of these selectivity determinants provides a structural framework for rational design of improved subtype-selective ligands .

Understanding these distinct binding mechanisms is crucial for the development of more selective and potent SSTR drugs. The structural insights gained from cryo-EM studies offer opportunities for structure-based drug design approaches aimed at creating compounds with enhanced selectivity profiles, which could lead to more effective therapies with reduced side effects .

What growth and body composition phenotypes are observed in Sstr1-/- mice?

Despite Sstr1's reported role in inhibiting growth hormone secretion, Sstr1 knockout mice display unexpected growth phenotypes. Sstr1-/- mice exhibit significantly reduced body weight accompanied by growth retardation . This counterintuitive finding suggests that Sstr1 may play complex roles in growth regulation beyond simple inhibition of growth hormone release, potentially involving interactions with other hormonal systems or developmental pathways.

The growth phenotype observed in these knockout models indicates that Sstr1 signaling contributes to normal growth processes, and its absence cannot be fully compensated by other somatostatin receptor subtypes. These observations highlight the importance of Sstr1 in physiological growth regulation and suggest that therapeutic targeting of this receptor subtype could potentially influence growth parameters .

How does Sstr1 ablation affect age-dependent glucose metabolism?

Sstr1 knockout mice exhibit striking age-dependent changes in glucose metabolism. At 3 months of age, Sstr1-/- mice display glucose intolerance with decreased systemic insulin secretion, despite showing increased insulin secretion in isolated pancreata perfusion experiments . This apparent paradox is explained by the significantly higher rate of insulin clearance observed in these animals compared to wild-type controls .

As the mice age, their metabolic phenotype undergoes a dramatic shift. By 12 months of age, Sstr1-/- mice develop increased glucose tolerance accompanied by exaggerated insulin levels . This temporal evolution of the metabolic phenotype suggests that:

  • Sstr1 plays different roles in glucose homeostasis at different life stages

  • Compensatory mechanisms may develop over time in response to Sstr1 deficiency

  • The interplay between Sstr1 and other components of the endocrine pancreas changes with age

These findings have important implications for understanding the role of Sstr1 in age-related metabolic disorders and highlight the complexity of somatostatin receptor signaling in metabolic regulation .

What are the key considerations for designing selective Sstr1 ligands?

Designing selective ligands for Sstr1 requires careful consideration of the unique structural features of its binding pocket. Recent structural biology studies have identified several critical residues that determine ligand selectivity across SSTR subtypes . When designing selective Sstr1 ligands, researchers should focus on engaging with these specific residues while avoiding interactions with conserved regions that would promote binding to other SSTR subtypes.

Key residues that have been identified as important for Sstr1 ligand binding include Q6.55 and S7.34 . Additional residues consistently involved in forming hydrophobic interactions with Sstr1 antagonists have also been characterized . Based on docking studies, several interaction patterns have been observed with high-scoring Sstr1 antagonists:

  • Hydrogen bonding with residues T5.43 and Q6.55

  • Hydrogen bonding with Y1.39

  • Hydrogen bonding with T2.64

Fluorene derivatives with modifications at the alkyl moiety have shown promising binding scores in computational studies, with values ranging from 5.04 to 7.04 . These compounds frequently form hydrogen bonds with residues T5.43 and Q6.55, suggesting these interactions contribute significantly to binding affinity .

How can researchers evaluate Sstr1 signaling in experimental systems?

Evaluating Sstr1 signaling in experimental systems requires multiple complementary approaches to capture the diverse signaling pathways coupled to this receptor. Since Sstr1 signals through both pertussis toxin-sensitive and -insensitive G proteins, researchers should implement assays that can detect multiple downstream pathways .

Recommended methodological approaches include:

  • Adenylyl cyclase inhibition assays: Since Sstr1 couples to inhibition of adenylyl cyclase via pertussis toxin-sensitive G proteins, measuring cAMP levels after receptor stimulation provides a direct readout of receptor activation .

  • Phosphotyrosine phosphatase activity assays: Sstr1 stimulates phosphotyrosine phosphatase via pertussis toxin-insensitive G proteins, offering an alternative pathway to monitor .

  • Na+/H+ exchanger activity measurements: This represents another pertussis toxin-insensitive pathway activated by Sstr1 .

  • Selective pharmacological tools: Using subtype-selective agonists like L-797591 helps distinguish Sstr1-mediated responses from those mediated by other SSTR subtypes .

  • Knockout or knockdown controls: Including Sstr1-/- cells or tissues as negative controls ensures signal specificity.

  • Pertussis toxin treatments: Comparing responses in the presence and absence of pertussis toxin helps differentiate between the different G protein coupling pathways.

These methodological approaches provide a comprehensive framework for characterizing Sstr1 signaling in various experimental systems, enabling researchers to distinguish Sstr1-mediated effects from those of other somatostatin receptor subtypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.