Recombinant Mouse Somatostatin receptor type 4 (Sstr4)

Shipped with Ice Packs
In Stock

Description

Key Features:

  • Molecular Weight: ~42 kDa (calculated), ~72 kDa observed due to glycosylation .

  • Expression Systems: Commonly expressed in HEK-293 cells , tobacco cell-free systems , or transgenic mouse models .

  • Functional Domains: Extracellular N-terminal for ligand binding, intracellular C-terminal for G-protein coupling .

Research Applications

Recombinant Sstr4 is pivotal in:

2.1. Neurological Studies

  • Pain and Mood Regulation: SST4 activation in glutamatergic neurons (hippocampus CA1/CA2, somatosensory cortex) reduces chronic pain and depression in transgenic mice .

  • Receptor Localization: RNAscope hybridization confirms Sstr4 expression in GABAergic interneurons (olfactory bulb) and glutamatergic neurons (amygdala, prelimbic cortex) .

2.2. Cancer Research

  • Tumor Expression: SST4 is upregulated in glioblastomas (IRS: 6.78), gastric cancers (IRS: 8.06), and lymphomas (IRS: 6.02) .

  • Therapeutic Targeting: SST4 agonists inhibit tumor proliferation via MAP kinase and STAT3 pathways .

2.3. Pharmacological Development

  • Drug Screening: Used to test SST4-specific agonists (e.g., J-2156) lacking endocrine side effects .

  • Antibody Validation: Monoclonal antibodies (e.g., Bio-Rad clone sstr4) enable precise receptor detection in Western blot (1:2,000 dilution) and ELISA .

4.1. Expression Patterns

  • Central Nervous System: Highest expression in cerebral cortex, hippocampus (CA1/CA2), and trigeminal ganglia .

  • Peripheral Tissues: Detected in adrenal cortex, pancreatic ducts, and placental syncytiotrophoblasts .

4.2. Signaling Mechanisms

  • Inhibitory Pathways: Reduces cAMP via adenylate cyclase inhibition and activates MAPK/STAT3 for antiproliferative effects .

  • Ion Channel Modulation: Suppresses Ca²⁺ influx and hyperpolarizes membranes via GIRK channels .

4.3. Species-Specific Differences

  • Human vs. Mouse: Humanized SST4 mice (Chr3 line) show distinct cortical layer expression (layers II/III vs. layer V in wild-type mice) .

Challenges and Innovations

  • Antibody Limitations: Lack of species-specific antibodies resolved using SST4-eGFP knockin models .

  • Transgenic Models: PiggyBac transposon-generated humanized mice enable translational drug testing .

Table 1: SST4 Expression in Human Tumors

Tumor TypePositive Samples (%)Mean IRS
Glioblastoma100%6.78
Gastric Cancer100%8.06
Pancreatic Adenocarcinoma90.9%6.27
Lymphoma83.3%6.02

Table 2: Recombinant Sstr4 Constructs

FeatureHEK-293 ExpressedCell-Free Expressed
TagHis-tagStrep-tag
Yield>90%70–80%
Post-Translational ModificationsGlycosylation confirmedMinimal modifications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes section, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing your preferred tag.
Synonyms
Sstr4; Smstr4; Somatostatin receptor type 4; SS-4-R; SS4-R; SS4R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Sstr4
Target Protein Sequence
MNAPATLLRGVEDTTWTPGINASWAPEQEEDAMGSDGTGTAGMVTIQCIYALVCLVGLVG NALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVRSAAALRHWPFGAVLCRAVLS VDGLNMFTSVFCLTVLSVDRYVAVVHPLRTATYRRPSVAKLINLGVWLASLLVTLPIAVF ADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLPPVLAIGLCYLLIVGKMRAVALR GGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANS CANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGAGCICPPL PCQQEPVQAEPGCKQVPFTKTTTF
Uniprot No.

Target Background

Function
Somatostatin receptor type 4 (Sstr4) acts as a receptor for somatostatin-14. Its activity is mediated by G proteins, leading to the inhibition of adenylyl cyclase. Beyond inhibiting adenylyl cyclase, Sstr4 is functionally coupled to the activation of both arachidonate release and the mitogen-activated protein (MAP) kinase cascade.
Gene References Into Functions
  1. This study provides the first evidence that somatostatin 4 receptor activation is implicated in the behavioral and neuroendocrine alterations caused by chronic stress. Notably, the study highlights the crucial role of plastic changes in the amygdala. PMID: 28161436
  2. The findings of this research indicate that sst4 mediates anxiolytic and antidepressant-like effects by enhancing the stress-responsiveness of several brain regions, with a particular emphasis on the amygdala. PMID: 26387439
  3. SSTR4 and delta-Opioid receptor (dOR) form a heteromeric complex and function synergistically. PMID: 24416361
  4. SSTR4-like immunoreactivity is elevated in ApoD(-/) mice within all major nuclei of the hypothalamus, median eminence, and ependymal cells of the third ventricle. PMID: 22581439
  5. The ablation of SSTR4 impacts inflammatory peptide and receptor expression in both the non-inflamed and inflamed murine intestine. PMID: 19426160
  6. The effect of sst2 receptor knockout on sst4 receptor mRNA localization and binding sites throughout the brain has been meticulously investigated. PMID: 11897118
  7. Somatostatin sst(4) receptor-selective agonists hold significant potential as novel candidates for the development of anti-inflammatory drugs targeting airway inflammation and hyperresponsiveness. PMID: 17961545
  8. Somatostatin receptor subtype 4 couples to the M-current to regulate seizures. PMID: 18385315
  9. During inflammatory conditions, the released somatostatin exerts pronounced counterregulatory effects through sst(4) receptor activation. PMID: 19622729
  10. Comprehensive research has elucidated the expression, localization, and inflammation-induced alterations of sst(4) receptors in both murine and human lungs. PMID: 19687471

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Sstr4 and what are its primary functions in mouse models?

Sstr4 is one of five G-protein-coupled somatostatin receptors (designated SST1-SST5) that mediate the actions of somatostatin. In mouse models, Sstr4 has been demonstrated to mediate several important physiological functions including:

  • Analgesic effects in pain modulation pathways

  • Anti-inflammatory responses in various tissues

  • Anti-anxiety and antidepressant-like behaviors

  • Anti-amyloid effects relevant to neurodegenerative conditions

  • Neuronal inhibition without influencing hormone secretion (unlike other somatostatin receptor subtypes)

The receptor functions primarily through coupling to Gi/o proteins, which inhibits adenylate cyclase and leads to reduced cAMP production. In neuronal populations, Sstr4 activation reduces intracellular Ca²⁺ concentrations by inhibiting voltage-dependent Ca²⁺ channels and activates potassium channels, resulting in membrane hyperpolarization .

Where is Sstr4 predominantly expressed in mouse tissues?

Expression analysis through RT-qPCR and in situ hybridization has revealed that mouse Sstr4 shows the following expression pattern:

Tissue/RegionExpression LevelPrimary Cell Types
Cerebral cortexHighGlutamatergic neurons (layers II-IV)
Olfactory bulbHighGlomerular layer
Trigeminal gangliaHighSensory neurons
LungsHighVarious cell types
EpididymisModerate-HighVarious cell types
HippocampusModerateCA1 region, glutamatergic neurons
AmygdalaModerateCentral nucleus

In brain tissue, Sstr4 is predominantly localized in glutamatergic excitatory neurons in most regions, with selective expression in GABAergic interneurons only in specific regions such as the central amygdala .

How does Sstr4 signaling differ from other somatostatin receptor subtypes?

Sstr4 exhibits several unique signaling characteristics that distinguish it from other somatostatin receptor subtypes:

  • It is the only somatostatin receptor subtype that does not significantly influence endocrine function while still mediating analgesic and anti-inflammatory effects .

  • It demonstrates complex and sometimes opposing effects on cell proliferation:

    • It can inhibit proliferation via tyrosine phosphatase SHP-2 activation and upregulation of cyclin-dependent kinase inhibitor p21

    • It can stimulate proliferation via protein kinase C activation and MAP kinase-mediated STAT3 activation

  • Species-specific differences in trafficking behavior have been observed:

    • Human Sstr4 shows rapid internalization and recycling after ligand binding

    • Rat Sstr4 demonstrates minimal to no internalization following ligand binding

This unique signaling profile makes Sstr4 particularly relevant as a target for developing non-hormonal therapeutics for pain and inflammation.

What are the most effective approaches for studying Sstr4 function in vivo?

Several methodological approaches have proven effective for investigating Sstr4 function in vivo:

  • Genetic knockout models: Sstr4 knockout (KO) mice have been extensively utilized to study the receptor's function, particularly in pain, inflammation, and neurological disorders. Studies with these mice have revealed increased spontaneous epileptic seizures and altered responses to inflammatory stimuli, highlighting Sstr4's physiological roles .

  • Pharmacological studies: Synthetic selective SST4 receptor agonists, such as J-2156, have been employed to study receptor function. These studies have confirmed Sstr4's role in modulating pain and depression-like behaviors .

  • Humanized mouse models: To overcome species differences between human and mouse Sstr4 expression and signaling, humanized mice expressing the human SSTR4 gene in a mouse Sstr4-deficient background have been developed. These models are particularly valuable for translational research and drug development targeting the human receptor .

  • Reporter gene constructs: Transgenic mice expressing fluorescent or bioluminescent reporters linked to Sstr4 (e.g., SST4-eGFP fusion proteins) enable visualization of receptor expression patterns in different tissues and cell types .

The choice of model should be guided by the specific research question, considering the strengths and limitations of each approach.

How can researchers generate humanized Sstr4 mouse models for translational research?

Generation of humanized Sstr4 mouse models involves several methodological steps:

  • Vector construction: Create a transposon vector containing the human SSTR4 gene (hSSTR4) with human regulatory elements, along with a reporter gene construct (e.g., luciferase or fluorescent protein) to visualize expression. Flanking insulator regions help isolate the construct from positional effects .

  • Delivery method: Microinject the vector construct into Sstr4-deficient mouse zygotes along with PiggyBac (PB) transposase mRNA to facilitate random insertion into the genome .

  • Founder identification: Screen offspring for transgene integration using PCR and verify the absence of vector backbone sequences, which could interfere with expression .

  • Line establishment: Cross transgene-positive mice with Sstr4-deficient mice to establish stable lines. Multiple founder lines should be generated, as integration site can significantly affect expression patterns .

  • Expression characterization: Validate expression using:

    • In vivo bioluminescent imaging of reporter gene activity

    • RT-qPCR to quantify expression levels across tissues

    • In situ hybridization to identify specific cell types expressing the receptor

This approach has successfully generated humanized Sstr4 mice that express the human receptor in brain regions relevant to pain and mood regulation, providing valuable tools for preclinical drug development .

What techniques are most reliable for detecting Sstr4 protein expression?

Due to historical challenges with antibody specificity, a combination of complementary techniques is recommended for reliable Sstr4 detection:

  • Genetically modified reporter systems: SST4-eGFP knockin mice expressing a carboxyl-terminal fusion protein provide the most reliable visualization of native expression patterns. The fluorescent tag allows direct detection without relying on antibodies .

  • Validated monoclonal antibodies: The rabbit monoclonal anti-human SST4 antibody 7H49L61 has been extensively characterized and validated for immunohistochemical studies. Key validation steps include:

    • Testing on transfected cells expressing known levels of the receptor

    • Immunoblot confirmation of appropriate molecular weight bands (50-60 kDa)

    • Peptide competition assays to confirm specificity

    • Comparison with knockout/negative controls

  • In situ hybridization: RNAscope technology allows for highly sensitive and specific detection of Sstr4 mRNA in tissue sections, with the ability to perform co-localization studies with other neural markers such as Vglut1 (glutamatergic neurons) and Gad1 (GABAergic neurons) .

  • RT-qPCR: For quantitative assessment of expression levels across tissues, RT-qPCR remains a reliable technique when performed with appropriate controls and validated primers specific to either mouse Sstr4 or human SSTR4 .

The combination of protein and mRNA detection methods provides the most comprehensive and reliable assessment of Sstr4 expression.

How do species differences between human and mouse Sstr4 impact translational research?

Several important species differences between human SSTR4 and mouse Sstr4 affect translational research:

  • Expression pattern differences:

    • In the olfactory bulb, mouse Sstr4 is predominantly expressed in the glomerular layer, while human SSTR4 in transgenic mice shows expression primarily in the granular layer .

    • In the somatosensory cortex, mouse Sstr4 shows higher expression in layers II-IV, whereas human SSTR4 shows relatively higher expression in layer V .

    • Human SSTR4 appears in both glutamatergic and GABAergic neurons in multiple brain regions, while mouse Sstr4 is more restricted to glutamatergic neurons in most regions .

  • Receptor trafficking dynamics:

    • Human SSTR4 undergoes rapid internalization and recycling after ligand binding

    • Rat/mouse Sstr4 shows minimal to no internalization following agonist exposure

  • Pharmacological responses:

    • Differential responses to synthetic agonists have been observed, necessitating human receptor-expressing systems for drug development

    • Species-specific differences in binding affinity and signaling efficacy have been reported

These differences highlight the importance of humanized mouse models for translational research, particularly for preclinical evaluation of SST4-targeting drug candidates. Researchers should carefully consider these species differences when designing experiments and interpreting results from animal models.

What are the key considerations when designing experiments to investigate Sstr4 signaling pathways?

When investigating Sstr4 signaling pathways, researchers should consider:

  • Selection of appropriate model systems:

    • Cell lines with confirmed endogenous expression or controlled transfection

    • Primary cultures from relevant tissues (cortical neurons, trigeminal ganglia)

    • In vivo models with genetic manipulation (knockout, humanized)

  • Signaling pathway specificity:

    • Sstr4 couples primarily to Gi/o proteins, inhibiting adenylate cyclase

    • Downstream effects include reduced cAMP, inhibition of voltage-dependent Ca²⁺ channels, and activation of K⁺ channels

    • Effects on MAPK pathways and tyrosine phosphatases should be monitored

  • Temporal dynamics of signaling:

    • Acute vs. chronic activation may produce different outcomes

    • Receptor desensitization and trafficking patterns differ between species

  • Cell-type specific effects:

    • Neuronal responses (membrane hyperpolarization, decreased excitability)

    • Effects on inflammatory cells and mediators

    • Cell proliferation effects (inhibitory or stimulatory depending on context)

  • Methodological approaches:

    • Use selective agonists (J-2156) rather than somatostatin itself to isolate Sstr4-specific effects

    • Employ multiple complementary techniques to measure signaling outcomes

    • Include appropriate controls (receptor antagonists, pathway inhibitors)

Researchers should be aware that Sstr4 signaling can produce apparently contradictory effects (e.g., both pro- and anti-proliferative) depending on cell type, experimental conditions, and downstream signaling pathways engaged.

What is the evidence for Sstr4 as a therapeutic target in neurological and inflammatory conditions?

Substantial evidence supports Sstr4 as a promising therapeutic target:

  • Pain and inflammation:

    • Sstr4 knockout mice show enhanced inflammatory responses and hyperalgesia

    • Selective Sstr4 agonists demonstrate analgesic and anti-inflammatory effects without hormonal side effects

    • Expression in trigeminal ganglia suggests relevance for migraine and facial pain

  • Epilepsy:

    • Sstr4 knockout mice exhibit increased spontaneous epileptic seizures

    • Reduced somatostatin binding in the hippocampal CA1 area correlates with seizure susceptibility

  • Cognition and memory:

    • Sstr4 influences memory, cognition, and learning performance

    • Impact on behavior in stressful situations has been demonstrated

    • Potential relevance for cognitive decline in aging

  • Neurodegenerative disorders:

    • Evidence suggests Sstr4 as a pharmacological target for Alzheimer's disease

    • Anti-amyloid effects have been documented

    • Neuroprotective properties in various models of neurodegeneration

This evidence base has stimulated pharmaceutical interest in developing non-peptide Sstr4 agonists as a novel class of therapeutics. The selective expression pattern and unique signaling profile of Sstr4 may allow for targeted treatments with fewer side effects compared to current therapies for these conditions.

What are the primary challenges in developing specific antibodies and tools for Sstr4 research?

Researchers face several technical challenges when developing specific tools for Sstr4 research:

  • Antibody specificity issues:

    • High sequence homology between different somatostatin receptor subtypes

    • Conservation of transmembrane domains makes unique epitope identification difficult

    • Post-translational modifications and conformational changes affect antibody recognition

    • Low expression levels in many tissues hamper validation

  • Pharmacological tool limitations:

    • No commercially available SST4 receptor-specific antagonists exist

    • Peptide agonists may cross-react with other somatostatin receptor subtypes

    • Species differences in binding pockets affect ligand specificity

  • Expression detection challenges:

    • Low endogenous expression levels in many tissues

    • Non-specific binding in immunohistochemical applications

    • Difficulties in distinguishing between splice variants

These challenges have historically made SST4 the least characterized of the five somatostatin receptor subtypes. Recent advances, including the development of the rabbit monoclonal anti-human SST4 antibody 7H49L61 and generation of reporter mouse models, are beginning to address these limitations .

How can researchers address discrepancies in reported Sstr4 expression patterns across different studies?

To address discrepancies in reported Sstr4 expression patterns, researchers should:

  • Employ multiple complementary detection methods:

    • Combine mRNA detection (RT-qPCR, in situ hybridization) with protein localization techniques

    • Use reporter gene constructs when possible

    • Apply single-cell approaches to resolve cell type-specific expression

  • Consider methodological variables:

    • Tissue preparation methods (fixation, antigen retrieval)

    • Probe/antibody specificity and validation

    • Detection sensitivity thresholds

    • Age, sex, and strain differences in experimental animals

  • Account for species differences:

    • Clearly distinguish between studies of human SSTR4 and mouse/rat Sstr4

    • Be aware that expression patterns differ between species, as demonstrated in comparative studies

  • Report contextual factors:

    • Developmental stage (expression changes throughout development)

    • Physiological/pathological state (expression can be regulated by disease conditions)

    • Regional and cellular heterogeneity within tissues

A systematic approach that acknowledges these variables will help reconcile apparently contradictory findings and build a more accurate understanding of Sstr4 expression patterns.

What are the most promising future directions for Sstr4 research in neuroscience and immunology?

Several promising research directions for Sstr4 are emerging:

  • Therapeutic development:

    • Design of highly selective non-peptide Sstr4 agonists for chronic pain and inflammatory conditions

    • Investigation of Sstr4 targeting for treatment-resistant depression

    • Exploration of potential applications in neurodegenerative diseases, particularly Alzheimer's disease

  • Mechanistic understanding:

    • Elucidation of cell-type specific signaling mechanisms

    • Investigation of interactions between Sstr4 and other receptor systems

    • Understanding the role of Sstr4 in neuronal circuit function and plasticity

  • Advanced models:

    • Development of conditional and inducible Sstr4 knockout/knockin models

    • Generation of humanized models that more precisely recapitulate human receptor expression patterns

    • Creation of patient-derived cellular models for personalized medicine approaches

  • Clinical translation:

    • Identification of biomarkers that predict responsiveness to Sstr4-targeted therapies

    • Development of PET ligands for in vivo imaging of Sstr4 in human brain

    • Clinical trials of novel Sstr4 agonists for pain, inflammation, and neuropsychiatric disorders

These research directions are further supported by the demonstrated role of Sstr4 in modulating both neuronal excitability and inflammatory processes, positioning it at the intersection of neuroscience and immunology with broad therapeutic potential.

What are the best experimental systems for screening potential Sstr4-targeting compounds?

Researchers developing Sstr4-targeting compounds should consider a multi-tiered screening approach:

  • Primary screening platforms:

    • Cell lines stably transfected with human SSTR4

    • BRET/FRET-based G-protein coupling assays

    • cAMP accumulation assays (Sstr4 inhibits adenylate cyclase)

    • Ca²⁺ influx measurements in neuronal models

  • Secondary validation systems:

    • Primary cultures from humanized Sstr4 mice

    • Brain slice electrophysiology (measuring hyperpolarization)

    • Receptor internalization and trafficking assays

    • Competitive binding assays with radiolabeled somatostatin

  • In vivo models for lead compounds:

    • Humanized Sstr4 mice for efficacy testing

    • Inflammatory pain models (carrageenan, complete Freund's adjuvant)

    • Depression/anxiety behavioral paradigms

    • Seizure models to assess neuronal excitability

The ideal screening cascade should incorporate both human and mouse receptor systems to account for species differences, with progression from high-throughput cellular assays to more complex physiological models as compounds advance.

How should researchers design experiments to compare wild-type, knockout, and humanized Sstr4 mouse models?

When designing comparative studies across different Sstr4 mouse models, researchers should:

  • Ensure genetic background consistency:

    • Use littermate controls whenever possible

    • Backcross to achieve consistent genetic background (typically C57BL/6)

    • Consider the potential influence of flanking genes in knockout models

  • Include comprehensive phenotyping:

    • Baseline characterization (development, general health, behavior)

    • Receptor expression mapping (mRNA, protein, reporter expression)

    • Functional assessments relevant to known Sstr4 roles (pain, inflammation, cognition)

  • Design challenge experiments:

    • Inflammatory stimuli (LPS, carrageenan, formalin)

    • Pain models (thermal, mechanical, inflammatory)

    • Cognitive/behavioral challenges (learning, memory, stress)

    • Pharmacological challenges with Sstr4 agonists (e.g., J-2156)

  • Control for potential confounders:

    • Age and sex-matched groups

    • Consistent environmental conditions

    • Blinded assessment of outcomes

    • Power analysis to determine appropriate sample sizes

A comprehensive experimental design comparing wild-type, knockout, and humanized models can reveal not only the native function of Sstr4 but also identify important species differences that might impact translational research.

What considerations are important when interpreting contradictory findings on Sstr4 function across different experimental systems?

When faced with contradictory findings on Sstr4 function, researchers should consider:

  • Species-specific differences:

    • Human SSTR4 and mouse Sstr4 show differences in:

      • Expression patterns

      • Trafficking behavior

      • Signaling pathways

      • Pharmacological responses

  • Methodological variables:

    • Receptor overexpression vs. endogenous expression systems

    • Acute vs. chronic receptor activation

    • In vitro vs. in vivo experimental contexts

    • Detection sensitivity and specificity limitations

  • Receptor interaction complexities:

    • Potential formation of homo- or heterodimers with other receptors

    • Scaffold protein interactions affecting signaling

    • G-protein coupling preferences in different cell types

  • Developmental and regulatory factors:

    • Age-dependent expression changes

    • Pathological regulation of receptor expression

    • Influence of genetic background on receptor function

  • Experimental analysis limitations:

    • Statistical power and appropriate controls

    • Reproducibility across laboratories

    • Publication bias toward positive findings

By systematically analyzing these factors, researchers can often reconcile apparently contradictory findings and develop a more nuanced understanding of context-dependent Sstr4 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.