Recombinant Mouse Spastin (Spast)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Spastin (Spast)

Recombinant Mouse Spastin (Spast) is a lab-produced version of the spastin protein found in mice, generated using an E. coli expression system . Spastin, encoded by the SPAST gene, is an evolutionarily conserved protein crucial for microtubule (MT) dynamics . It belongs to the ATPase Associated with various cellular Activities (AAA) protein family and functions as a microtubule-severing enzyme .

Mutations in the SPAST gene are the most common cause of hereditary spastic paraplegia (HSP) . HSP is a neurodegenerative disorder characterized by progressive lower limb spasticity and weakness .

Function and Significance of Spastin

Spastin plays a vital role in various cellular functions, notably in neurons, where it influences axon biology . Its functions include:

  • Microtubule Severing: Spastin severs microtubules, a process essential for regulating microtubule dynamics . It tugs the C-terminal tail of tubulin, generating mechanical force through ATP hydrolysis .

  • Coordination of Organelle Dynamics: Spastin coordinates the shape of the endoplasmic reticulum (ER) and the dispersion of lipid droplets (LDs) . It modulates the levels and location of other HSP-related proteins like Seipin and REEP1 .

  • Axonal Development and Regeneration: Spastin interacts with CRMPs (CRMP1-5), which are involved in neuronal development and regeneration. These interactions modulate microtubule dynamics, neurite outgrowth, and axon regeneration .

Spastin Isoforms and Their Roles

Spastin has different splice isoforms that impact organelles, with the M1 isoform determining lipid droplet dispersion by organizing the ER along microtubules . Mutations in Spastin M1 disrupt this mechanism, affecting organelle dynamics and lipid profiles .

Spastin and Hereditary Spastic Paraplegia (HSP)

Mutations in the SPAST gene are a major cause of autosomal dominant HSP . These mutations can impair microtubule dynamics and disrupt the coordination between the ER and lipid droplets .

Research Findings on Spastin

  • Spastin's Role in Lipid Droplet Dispersion: Research indicates that Spastin influences lipid droplet dispersion and ER shape along microtubules. Disruption of this system can lead to HSP clinical features and impact lipid profiles .

  • Interaction with CRMPs: Spastin interacts with CRMP2, CRMP3, and CRMP5, influencing microtubule dynamics and neurite outgrowth .

  • Regulation by MDM2: MDM2, a protein, binds to spastin and regulates its levels. This interaction affects spastin poly-ubiquitination and protein levels, adding complexity to spastin regulation .

Therapeutic Approaches

Pharmacological studies in animal models suggest potential therapeutic targets for HSP. Methylene blue, salubrinal, guanabenz, and phenazine have shown promise in rescuing locomotor and cellular defects in SPAST mutant animals by targeting the ER stress response .

Tables

ProteinFunction
SpastinMicrotubule severing, coordination of ER shape and lipid droplet dispersion
CRMP2Modulation of MT dynamics, neurite outgrowth and axon regeneration
CRMP3Enhanced neurite length and total number of branching neurites
CRMP5Regulation MT dynamics and neurite outgrowth
MDM2Regulates spastin poly-ubiquitination and protein levels

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Spast; Kiaa1083; Spg4; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-614
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Spast
Target Protein Sequence
MSSPAGRRKKKGSGGASPAPARPPPPAAVPAPAAGPAPAAGSPPKRNPSSFSSPLVVGFA LLRLLACHLGLLFAWLCQRFSRALMAAKRSSGTAPAPASPSPPEPGPGGEAESVRVFHKQ AFEYISIALRIDEEEKAGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQYERARRLQAKMM TNLVMAKDRLQLLEKLQPVLQFSKSQTDVYNESTNLTCRNGHLQSESGAVPKRKDPLTHA SNSLPRSKTVLKSGSAGLSGHHRAPSCSGLSMVSGARPGPGPAATTHKGTPKPNRTNKPS TPTTAVRKKKDLKNFRNVDSNLANLIMNEIVDNGTAVKFDDIAGQELAKQALQEIVILPS LRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAAESNATFFNISAASLTSKYVGEGEKL VRALFAVARELQPSIIFIDEVDSLLCERREGEHDASRRLKTEFLIEFDGVQSAGDDRVLV MGATNRPQELDEAVLRRFIKRVYVSLPNEETRLLLLKNLLCKQGSPLTQKELAQLARMTD GYSGSDLTALAKDAALGPIRELKPEQVKNMSASEMRNIRLSDFTESLKKIKRSVSPQTLE AYIRWNKDFGDTTV
Uniprot No.

Target Background

Function

Spastin is an ATP-dependent microtubule-severing protein that specifically targets and cleaves polyglutamylated microtubules. It exhibits a preference for microtubules with short polyglutamate tails, with severing activity increasing as the number of glutamates per tubulin rises from one to eight, then decreasing beyond this threshold. Activity is independent of tubulin acetylation or detyrosination. Microtubule severing facilitates reorganization of cellular microtubule arrays and the release of microtubules from the centrosome post-nucleation. It plays a crucial role in the biogenesis and maintenance of complex microtubule networks in axons, spindles, and cilia. Spastin is involved in cytokinesis abscission and nuclear envelope reassembly during anaphase, cooperating with the ESCRT-III complex. It is recruited to the midbody (likely via IST1) and participates in membrane fission during abscission alongside the ESCRT-III complex. Recruitment to the nuclear membrane by IST1 mediates microtubule severing, promoting nuclear envelope sealing and mitotic spindle disassembly in late anaphase. Spastin is also required for ER-to-Golgi membrane traffic and endosome recycling. IST1 recruits it to endosomes, where it regulates early endosomal tubulation and recycling through microtubule severing. It likely contributes to axon growth and axonal branching. Additionally, Spastin may regulate lipid metabolism by influencing lipid droplet size and distribution.

Gene References Into Functions
  1. Axon branch loss at developing mouse neuromuscular junctions is mediated by branch-specific microtubule severing via the microtubule-severing enzyme spastin. PMID: 27773584
  2. Spastin recruitment is facilitated by microtubule polyglutamylation, induced by Tau missorting and subsequent TTLL6 (Tubulin-Tyrosine-Ligase-Like-6) translocalization into dendrites. PMID: 24065130
  3. Spastin deficiency in cortical neurons results in early and significant impairment of microtubule dynamics along axons, contributing to axonal swellings and cargo stalling. PMID: 22773755
  4. Research focused on identifying critical SPG4 gene promoter regions and the effects of Elk1 on SPG4 gene expression. PMID: 21395583
  5. Sequence analysis of the SPG4 (spastin) gene revealed a novel 1593 C>T (GLN490Stop) mutation associated with hereditary spastic paraplegia and cerebellar ataxia. PMID: 15667412
  6. Two modes of microtubule severing during axonal branch formation were identified, based on spastin concentration at branch points and local detachment from microtubules of molecules like tau, which regulate P60-katanin severing properties. PMID: 18234839
  7. Findings strongly support a direct role for defective axonal transport in the pathogenesis of HSP due to spastin mutations. PMID: 19453301
Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Endoplasmic reticulum. Midbody. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus. Cytoplasm, cytoskeleton, spindle. Cytoplasm.; [Isoform 1]: Endoplasmic reticulum membrane; Peripheral membrane protein. Nucleus membrane. Lipid droplet. Cytoplasm, cytoskeleton. Endosome.; [Isoform 2]: Cytoplasm. Endosome. Nucleus membrane.
Tissue Specificity
Expressed in brain, heart, liver, lung, skeletal muscle, spinal cord, spleen and testis.

Q&A

What are the key domains of mouse spastin important for recombinant protein studies?

Mouse spastin contains several functional domains crucial for its activity. The microtubule-binding domain (MTBD) is essential for interaction with microtubules, while the AAA (ATPases Associated with diverse cellular Activities) domain is responsible for ATP hydrolysis and subsequent microtubule severing. For recombinant studies, researchers often use a truncated version called spastin-C389, which lacks the N-terminal 225 amino acids but retains all domains required for severing activity . The truncation strategy improves solubility while maintaining enzymatic function.

Which expression systems are most effective for producing recombinant mouse spastin?

E. coli is commonly used for expressing recombinant mouse spastin, particularly for biochemical and structural studies. The Rosetta (DE3) strain has proven effective for spastin expression . For mammalian expression, HEK293T cells have been successfully employed, particularly for human spastin which shares high sequence identity with mouse spastin . The choice depends on the research application:

Expression SystemAdvantagesLimitationsBest Application
E. coli (Rosetta DE3)High yield, economical, rapid expressionLimited post-translational modificationsBiochemical assays, ATPase activity studies
HEK293TNative post-translational modifications, proper foldingLower yield, more expensiveInteraction studies, functional assays requiring PTMs

How can I optimize the expression conditions for recombinant mouse spastin in E. coli?

Systematic optimization of expression conditions is critical for obtaining soluble recombinant spastin. According to Wang's research, the following parameters should be tested:

  • IPTG concentration: Test concentrations ranging from 0.4-0.5 mM IPTG.

  • Induction temperature and time: Compare multiple conditions (37°C for 4h, 30°C for 6h, 16°C for 16h).

  • Media composition: Use rich media like LB with appropriate antibiotics.

  • Bacterial density at induction: Induce when OD600 reaches approximately 0.8.

The optimal conditions identified for spastin-C389 included induction at 30°C for 6h with 0.5 mM IPTG, which provided the best balance between expression level and protein solubility .

What purification strategy yields the highest purity and activity of recombinant mouse spastin?

A multi-step purification process is recommended:

  • Cell lysis: Resuspend cells in lysis buffer (20 mM HEPES, pH 7.4, 250 mM KCl, 25 μg/mL DNase, 25 μg/mL Lysozyme, 10 mM PMSF, 10 mM β-ME) followed by sonication .

  • Initial capture: For His-GST-tagged spastin, use glutathione or nickel affinity chromatography.

  • Tag removal: Consider protease cleavage (e.g., TEV protease) if the tag may interfere with functional studies.

  • Further purification: Ion exchange and size exclusion chromatography improve purity.

  • Storage: Store purified protein at -80°C in buffer containing 10% glycerol to maintain stability .

Yields of >80% purity can be achieved with this approach, as determined by SDS-PAGE and Coomassie blue staining .

How can I reliably measure the ATPase activity of recombinant mouse spastin?

The ATPase activity of recombinant spastin can be measured using a colorimetric assay based on malachite green:

  • Reaction setup: Use ATP as substrate supplemented with 1.4 μg enzyme in a 100 μL reaction system.

  • Controls: Include inactive spastin mutant (e.g., E439A) and denatured enzyme controls.

  • Reaction conditions: Incubate at 37°C for 3h.

  • Detection: Add 0.4 mL MG-AM color reagent, vortex immediately to terminate the reaction, wait 2 min, add 50 μL of 34% citrate solution, vortex, and record absorbance at 650 nm after 5 min.

  • Quantification: Calculate phosphate generated using a standard curve .

This approach allows for quantitative comparison between wild-type spastin and mutant variants to assess the impact of specific amino acid changes on enzymatic function.

What are the established methods for evaluating microtubule-severing activity of recombinant spastin?

Microtubule-severing activity can be assessed through multiple complementary approaches:

  • In vitro microtubule severing assay: Use fluorescently labeled microtubules (typically rhodamine-labeled) and observe their fragmentation after incubation with recombinant spastin using fluorescence microscopy.

  • Tubulin release assay: Measure the release of tubulin dimers from polymerized microtubules after treatment with spastin.

  • Cellular microtubule network visualization: Express recombinant spastin in cells and observe changes in microtubule organization using immunofluorescence.

Spastin preferentially recognizes and severs microtubules that are polyglutamylated, with severing activity increasing as the number of glutamates per tubulin rises from one to eight, but decreasing beyond this glutamylation threshold .

How do I design spastin mutations to study structure-function relationships?

When designing mutations to study structure-function relationships in spastin, focus on key functional domains:

  • AAA domain mutations: The E439A mutation in the AAA domain eliminates ATPase activity without disrupting protein folding, serving as an excellent negative control .

  • Nucleotide-binding site mutations: Design mutations in the N-loop (e.g., Q488V), P-loop (e.g., N527C, N527T), and sensor-II motif (e.g., T692A, S689A) to study inhibitor binding and nucleotide interactions .

  • Microtubule binding domain mutations: K353A mutation obliterates microtubule-severing activity without affecting protein folding .

  • Phosphorylation site mutations: Mutations at Ser210 can be used to study the role of phosphorylation in spastin function, independent of its microtubule-severing activity .

Use site-directed mutagenesis with two mutagenic primers and DNA polymerase followed by DpnI digestion to remove template DNA .

What are the critical residues for spastin function that should be considered in mutation studies?

Several critical residues have been identified that affect different aspects of spastin function:

ResidueDomainEffect of MutationApplication in Research
E439AAAA domainEliminates ATPase activityNegative control for enzymatic activity
K353AMTBDObliterates microtubule-severing activityStudy non-severing functions of spastin
Ser210N-terminalAffects phosphorylation and GluA2 interactionInvestigate AMPAR trafficking
N527C/TP-loopReduces inhibitor potencyStudy inhibitor binding mechanisms
Q488VN-loopReduces inhibitor potencyStudy inhibitor binding mechanisms
S689RSensor-IIYields inactive proteinUnderstand structural importance

These residues provide excellent targets for mutation studies to elucidate structure-function relationships .

How can I investigate interactions between recombinant spastin and AMPA receptors?

To study interactions between spastin and AMPA receptors, multiple complementary approaches can be employed:

  • Co-immunoprecipitation (Co-IP): Express tagged versions of spastin and AMPAR subunits (e.g., GluA1-4) in heterologous cells or use brain tissue lysates. Use antibodies against the tag or native proteins to pull down the complexes and analyze by Western blot .

  • Pull-down assays: Use purified recombinant spastin (or fragments) as bait to capture AMPAR subunits from cell lysates .

  • Surface plasmon resonance (SPR): Measure direct binding kinetics between purified recombinant spastin and AMPAR subunits.

Research has shown that phosphorylation of spastin enhances its interaction with the AMPAR subunit GluA2, with Ser210 being a critical phosphorylation site for this interaction .

What methodologies are effective for studying spastin interactions with CRMPs?

To investigate spastin interactions with Collapsin Response Mediator Proteins (CRMPs), consider these approaches:

  • Domain mapping: Spastin interacts with CRMP5 through amino acid residues 270-328 (corresponding to the MTBD) and with CRMP3 and CRMP2 through similar regions .

  • Co-transfection experiments: Primary hippocampal neurons co-transfected with CRMP3 and spastin show enhanced neurite length and total number of branching neurites, providing a functional readout of the interaction .

  • Cooperative effects: For CRMP2, phosphorylation of spastin decreases its microtubule severing efficiency and weakens the cooperative effect with CRMP2, negatively affecting branch formation and neurite outgrowth .

  • Microtubule severing assays: When spastin is co-transfected with CRMP5, microtubules are not severed by spastin, indicating that CRMP5 modulates spastin's enzymatic activity .

How can phosphorylation of recombinant spastin be studied in relation to AMPAR trafficking?

Studying the role of spastin phosphorylation in AMPAR trafficking requires multiple experimental approaches:

  • Phosphomimetic mutants: Generate recombinant spastin with serine-to-aspartate mutations (e.g., S210D) to mimic constitutive phosphorylation, or serine-to-alanine mutations (e.g., S210A) to prevent phosphorylation .

  • Surface expression assays: Transfect neurons with wild-type or mutant spastin and perform cell surface biotinylation assays to measure surface levels of GluA2 AMPAR subunits .

  • Electrophysiology: Record miniature excitatory postsynaptic currents (mEPSCs) in neurons expressing phosphorylated or non-phosphorylated forms of spastin. Phosphorylation of spastin increases both the amplitude and frequency of mEPSCs, indicating enhanced AMPAR surface expression .

  • Microtubule-independent mechanism: Use the K353A mutant (which lacks microtubule-severing activity) to demonstrate that spastin's effect on AMPAR trafficking is independent of microtubule dynamics .

Research has shown that phosphorylation of Ser210 is crucial for GluA2 surface expression, and this function of spastin is independent of its microtubule-severing activity .

What approaches can be used to develop chemical inhibitors of recombinant spastin for research applications?

Developing chemical inhibitors of spastin requires a systematic approach:

  • Screening strategy: Test selected heterocyclic scaffolds against wild-type spastin and engineered mutants with alterations in the nucleotide-binding site .

  • Structure-activity relationship studies: Use computational docking along with experimental data to guide improvements in compound potency and selectivity .

  • Resistance-conferring mutations: Identify spastin point mutations that confer resistance to the inhibitor, providing insights into the binding mechanism .

  • Validation in cellular systems: Generate inhibitor-sensitive and inhibitor-resistant cell lines to dissect spastin-specific phenotypes in parallel experiments .

This approach led to the development of spastazoline, a pyrazolyl-pyrrolopyrimidine-based cell-permeable probe for spastin that has been valuable for studying spastin function in dividing cells .

How can recombinant mouse spastin be used to study mechanisms of Hereditary Spastic Paraplegia (HSP)?

Recombinant mouse spastin provides valuable tools for studying HSP mechanisms:

  • Patient mutation modeling: Generate recombinant mouse spastin carrying mutations identified in HSP patients to study their effects on ATPase activity, microtubule severing, and protein-protein interactions .

  • Cellular phenotypes: Transfect neurons with wild-type or mutant spastin to examine effects on microtubule organization, axon outgrowth, and dendritic branching .

  • Synaptic function: Investigate how spastin mutations affect AMPAR trafficking and synaptic strength, potentially explaining cognitive deficits seen in some HSP patients .

  • High-throughput screening: Use purified recombinant spastin to screen for compounds that might restore function to mutant spastin proteins as potential therapeutic leads .

Mouse and human spastin are highly identical in protein sequence, making mouse spastin a relevant model for human disease studies. Several spastin mutation models in mice have been generated to evaluate the significance of spastin loss-of-function in mammals .

What strategies can address poor solubility of full-length recombinant mouse spastin?

Poor solubility is a common challenge when expressing full-length spastin. Several approaches can address this issue:

  • Use truncated constructs: The spastin-C389 construct (lacking N-terminal 225 amino acids) retains all domains required for severing activity while exhibiting improved solubility .

  • Optimize expression conditions: Lower induction temperatures (16-30°C) and extended induction times can improve proper folding and solubility .

  • Solubility tags: Use solubility-enhancing tags such as GST, MBP, or SUMO in fusion constructs.

  • Buffer optimization: Include glycerol (10%), low concentrations of non-ionic detergents, or increased salt concentrations in lysis and storage buffers to improve solubility .

  • Co-expression with chaperones: Co-express with molecular chaperones like GroEL/GroES to assist in proper folding.

How can I distinguish between the different isoforms of recombinant mouse spastin in experimental systems?

Mouse spastin exists in multiple isoforms, primarily M1 (full-length) and M85 (lacks the first 84 amino acids). To distinguish between these:

  • Size difference: Use SDS-PAGE and Western blotting to identify the isoforms based on molecular weight. M1 spastin is approximately 1.7 kDa larger than M85 .

  • Isoform-specific antibodies: Generate or obtain antibodies that specifically recognize epitopes in the N-terminal region present only in the M1 isoform.

  • Expression constructs: For recombinant expression, use constructs that specifically express one isoform or the other by selecting appropriate start codons .

  • Mass spectrometry: Use peptide mass fingerprinting to definitively identify isoforms based on the presence or absence of N-terminal peptides.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.