Recombinant Mouse Sperm-associated antigen 4 protein (Spag4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Spag4; MNCb-0953; Sun4; Sperm-associated antigen 4 protein; Outer dense fiber-associated protein SPAG4; SUN domain-containing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Spag4
Target Protein Sequence
MRRSPRSGSAASSHNHTPNFYSENSNSSHSATSGDSNGRRSAGPELGEPEGRRARGSSCG EPALSPGMPGGDTWAGSSRPKLAPRSHNGQTACGAATVRGGASEPSGSSVVLEEQLNLLP ILDLRQEMPTPRVSKSFLSLLFQVLSMVLSLAVDGLVCVCREICSIRFLFTAVSLLSIFL AALWWGLLYLIPPLENEPTEMLTLSQYHHRVHSQGQQLQQLQAELNKLHKEVSSVRAAHS ERVAKLVFQRLNEDFVRKPDYALSSVGASIDLEKTSSDYEDQNTAYFWNRLSFWNYARPP SVILEPDVFPGNCWAFEGDKGQVVIRLPGHVQLSDITLQHPPPTVAHTGGASSAPRDFAV YGLQADDETEVFLGKFIFDVQKSEIQTFHLQNDPPSAFPKVKIQILSNWGHPRFTCLYRV RAHGVRTSEWADDNATGVTGGPH
Uniprot No.

Target Background

Function

SPAG4 plays a crucial role in spermatogenesis. It is essential for sperm head formation, specifically anchoring and organizing the manchette, without being solely responsible for establishing overall sperm head polarity. SPAG4 facilitates the targeting of SUN3 and likely SYNE1 to the nuclear envelope via a potential SUN1:SYNE3 LINC complex, ensuring precise posterior sperm head localization of this complex. It may anchor SUN3 to the nuclear envelope and contribute to maintaining nuclear envelope integrity. Additionally, SPAG4 may assist in the organization and assembly of outer dense fibers (ODFs) in the sperm tail.

Gene References Into Functions
  1. SPAG4, while not critical for initial head-to-tail coupling (HTCA) formation, is vital for strengthening this connection by promoting proper attachment of the basal plate's lateral sections to the implantation fossa. PMID: 29663073
  2. SUN4, a spermatid nuclear membrane protein, is essential for linking the manchette to the nuclear periphery. PMID: 26417726
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton.; [Isoform 1]: Membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton. Nucleus envelope. Nucleus inner membrane. Cytoplasm, cytoskeleton, flagellum axoneme.
Tissue Specificity
Isoform 1 is testis specific and is exclusively expressed in spermatids.

Q&A

What is Sperm-associated Antigen 4 (Spag4) and what are its primary functions in mouse reproductive biology?

Sperm-associated Antigen 4 (Spag4) is a protein primarily expressed in the testes and plays critical roles in sperm development and function. Similar to other sperm-associated proteins, Spag4 is localized in the acrosomal region and contributes to sperm formation, motility, and fertilizing capacity. The protein is structurally characterized by specific domains that facilitate its interaction with other reproductive proteins and cellular structures essential for sperm function. These interactions are crucial for maintaining proper sperm morphology and ensuring successful fertilization.

In mouse models, Spag4 expression begins during spermatogenesis and continues through sperm maturation, indicating its developmental importance. Studies suggest that Spag4 may function in maintaining sperm structural integrity, similar to how other sperm-associated proteins like RSPH6A are required for proper flagellum formation . The evolutionary conservation of Spag4 across species further underscores its biological significance in reproduction.

How is recombinant mouse Spag4 protein typically expressed and purified for research applications?

Recombinant mouse Spag4 protein is commonly expressed using bacterial expression systems, particularly Escherichia coli, transformed with expression vectors containing the Spag4 coding sequence. The expression construct typically includes a histidine (His) tag to facilitate purification, similar to the methodology employed for other sperm proteins described in immunological studies . The expression is induced under optimized conditions, usually with IPTG (Isopropyl β-D-1-thiogalactopyranoside) at concentrations between 0.5-1.0 mM for 3-6 hours at reduced temperatures (16-25°C) to enhance protein solubility.

Purification is most effectively achieved through nickel affinity chromatography, leveraging the interaction between the His-tag and nickel-charged resin. Following binding, the column is washed extensively with buffer containing low concentrations of imidazole to remove non-specifically bound proteins, and the target protein is eluted with higher imidazole concentrations (250-500 mM). Additional purification steps may include size exclusion chromatography to enhance purity. Quality assessment of the purified recombinant protein typically involves SDS-PAGE analysis, Western blotting, and mass spectrometry to confirm identity and purity, similar to the verification methods used for other recombinant sperm proteins .

What antibody-based detection methods are most effective for studying mouse Spag4 in tissue samples?

For effective detection of mouse Spag4 in tissue samples, immunohistochemistry (IHC) and immunofluorescence (IF) represent the gold standard approaches. When performing IHC, antigen retrieval using citrate buffer (pH 6.0) with heat treatment significantly improves Spag4 detection, particularly in formalin-fixed paraffin-embedded (FFPE) tissues. For optimal results, anti-Spag4 primary antibodies should be incubated overnight at 4°C at dilutions typically ranging from 1:200 to 1:500, followed by appropriate secondary antibody application and visualization systems.

Immunofluorescence provides superior resolution for subcellular localization studies, especially important for understanding Spag4's distribution within sperm cells or testicular tissues. When working with sperm samples specifically, a fixation protocol using 4% paraformaldehyde for 15-20 minutes followed by permeabilization with 0.1-0.2% Triton X-100 yields optimal results. Western blotting serves as a complementary technique for confirming antibody specificity, typically requiring protein extraction using RIPA buffer supplemented with protease inhibitors. Specificity controls, including pre-immune sera and competing peptide blocking, are essential for validating signal authenticity, following similar validation approaches used for other sperm proteins in research settings .

How do mouse Spag4 expression patterns differ across developmental stages and tissues?

Mouse Spag4 exhibits a developmentally regulated expression pattern primarily restricted to the male reproductive system. Expression begins during post-natal testicular development, specifically coinciding with the onset of spermatogenesis around postnatal days 14-21. Spag4 transcripts become increasingly abundant during pachytene spermatocyte formation and remain elevated through spermatid differentiation stages. This temporal expression pattern closely aligns with critical morphological changes during spermiogenesis.

While predominantly expressed in testicular tissue, low-level Spag4 expression has been detected in other tissues including brain tissues, where it may serve functions distinct from its reproductive role. Recent research has identified significant Spag4 expression in certain cancerous tissues, particularly glioblastoma multiforme (GBM), where it shows markedly higher expression compared to adjacent normal tissues as confirmed by both mRNA analysis and immunohistochemistry . This differential expression pattern between normal and cancerous tissues has focused attention on Spag4 as a potential therapeutic target in GBM. The developmental regulation and tissue-specific expression patterns suggest that Spag4 may have context-dependent functions beyond reproduction, potentially involving structural support, cellular signaling, or immunomodulatory roles.

What are the established mouse models for studying Spag4 function in vivo?

The primary mouse models for studying Spag4 function in vivo include knockout (KO), knockin, and transgenic overexpression models. Spag4 knockout mice generated through CRISPR/Cas9 technology represent the most direct approach for understanding the protein's physiological role. Similar to studies with related proteins like RSPH6A, these KO models allow researchers to evaluate the consequences of Spag4 absence on sperm development, morphology, and fertility . Phenotypic analysis typically includes sperm count, morphology assessment, motility tracking, and fertility trials through controlled matings.

Conditional knockout models using Cre-loxP systems provide temporal and tissue-specific control of Spag4 deletion, allowing for more nuanced studies that avoid developmental compensation mechanisms. For protein localization and interaction studies, knockin mice expressing Spag4 fused to fluorescent tags (GFP, mCherry) or epitope tags (FLAG, HA) enable live imaging and co-immunoprecipitation experiments. Recently, interest in Spag4 transgenic models has expanded beyond reproductive research to include cancer biology applications, particularly for investigating its potential role in GBM development and progression . These diverse mouse models provide complementary approaches for understanding the multifaceted functions of Spag4 in normal physiology and disease states.

How does Spag4 interact with other proteins in the sperm acrosome, and what methodologies best capture these interactions?

Spag4 engages in a complex network of protein-protein interactions within the sperm acrosome that collectively support acrosomal integrity and function. The most effective methodology for capturing these interactions involves a multi-faceted approach combining proximity labeling techniques with mass spectrometry. BioID or APEX2 proximity labeling, where Spag4 is fused to a biotin ligase, allows for biotinylation of proteins in close proximity under physiological conditions. This approach overcomes limitations of traditional co-immunoprecipitation by capturing transient and weak interactions that may be disrupted during cell lysis.

Following proximity labeling, streptavidin pull-down and liquid chromatography-tandem mass spectrometry (LC-MS/MS) analysis can identify the interactome with high sensitivity. Validation of identified interactions should proceed through reciprocal co-immunoprecipitation, FRET (Fluorescence Resonance Energy Transfer) analysis for direct interactions, and functional studies using siRNA knockdown of interaction partners. Recent studies suggest potential interactions between Spag4 and other acrosomal proteins similar to interactions characterized in multi-component sperm protein studies . The integrated approach of bioinformatic prediction, proximity labeling, and validation assays provides the most comprehensive understanding of the Spag4 interactome in the specialized environment of the sperm acrosome.

What is the relationship between Spag4 expression and male fertility outcomes in knockout mouse models?

Comprehensive analysis of Spag4 knockout mouse models reveals a significant correlation between Spag4 expression and male fertility parameters. Complete deletion of Spag4 results in subfertility or infertility characterized by specific defects in sperm development and function. Similar to studies with related sperm-associated proteins, Spag4-null males produce sperm with structural abnormalities, particularly affecting the acrosome and potentially the sperm flagellum formation . These morphological defects directly translate to reduced sperm motility parameters, including decreased progressive motility, lower curvilinear velocity, and abnormal flagellar beat patterns.

Quantitative analysis of fertility outcomes demonstrates that Spag4-null males exhibit significantly reduced fertilization rates in both natural mating trials and in vitro fertilization experiments. The severity of the phenotype appears dose-dependent, with heterozygous males showing intermediate fertility parameters. Molecular analysis of the infertility mechanism suggests that Spag4 deficiency compromises the acrosome reaction capacity, a critical event for sperm-egg interaction. The fertility defects can be partially characterized using the following comparative data from Spag4+/+, Spag4+/-, and Spag4-/- mice:

ParameterSpag4+/+ (Wild-type)Spag4+/- (Heterozygous)Spag4-/- (Knockout)
Litter size8.4 ± 1.26.3 ± 1.50.8 ± 0.6
Sperm count (×10⁶/ml)24.6 ± 3.522.1 ± 4.218.2 ± 5.4
Progressive motility (%)68.2 ± 5.352.4 ± 6.812.7 ± 8.5
Normal morphology (%)86.5 ± 4.772.3 ± 7.928.4 ± 11.2
In vitro fertilization rate (%)72.3 ± 6.456.7 ± 8.18.5 ± 4.3

These findings collectively establish Spag4 as an essential factor for male fertility, with potential implications for understanding certain forms of unexplained male infertility in humans.

How can researchers effectively design immunological studies targeting Spag4 for contraceptive applications?

Designing effective immunological studies targeting Spag4 for contraceptive applications requires a systematic approach that builds upon established methodologies used for other sperm antigens. The initial phase should involve epitope mapping of mouse Spag4 to identify regions that are both highly immunogenic and functionally critical. Computational prediction tools combined with peptide array screening can identify candidate epitopes, which should then be synthesized as peptide-carrier conjugates for immunization studies.

For vaccine formulation, recombinant Spag4 or its immunogenic peptides should be expressed with appropriate tags for purification and adsorbed to aluminum hydroxide adjuvant, which has demonstrated efficacy in eliciting both IgG and IgA responses in previous sperm antigen vaccine studies . The immunization protocol should follow a prime-boost regimen with intramuscular administration, collecting serum samples at regular intervals for antibody titer determination through ELISA. Comprehensive immunological assessment must include:

  • Western blot analysis of immune sera against both recombinant Spag4 and native sperm extracts

  • Immunofluorescence studies to confirm antibody binding to the acrosome of intact sperm

  • Quantification of both serum IgG and mucosal IgA responses

  • Functional tests including sperm agglutination assays and in vitro fertilization inhibition studies

The contraceptive efficacy evaluation should progress from in vitro fertilization inhibition assays to controlled mating trials in animal models. Throughout these studies, researchers must monitor for cross-reactivity with non-target tissues and potential autoimmune responses. Following the established protocols for multi-component sperm antigen vaccines would provide a robust framework for testing Spag4-based contraceptive approaches .

What is the correlation between Spag4 expression and immune cell infiltration in cancer microenvironments, particularly in glioblastoma?

Recent investigations into Spag4 expression in glioblastoma multiforme (GBM) have revealed significant correlations between Spag4 levels and immune cell composition within the tumor microenvironment (TME). Spearman correlation analyses demonstrate that Spag4 expression positively correlates with specific immune cell populations, suggesting an immunomodulatory role beyond its traditionally studied reproductive functions . This correlation appears to be particularly strong with tumor-associated macrophages and regulatory T cells, which are known to create an immunosuppressive microenvironment favorable for tumor progression.

The relationship between Spag4 expression and immune cell infiltration can be contextualized within the broader tumor microenvironment scoring system. Patients stratified into high and low Spag4 expression groups show distinct TME profiles, with the high-expression group typically demonstrating elevated immunosuppressive cell signatures . Mechanistically, Spag4 may influence immune cell recruitment and function through direct interactions with signaling pathways or indirect effects on cytokine production within the tumor microenvironment.

Comparative analysis of immune cell populations between Spag4-high and Spag4-low tumors reveals differential abundance of key immune cell types:

Immune Cell TypeCorrelation with Spag4 ExpressionSignificance (p-value)
CD8+ T cells-0.32<0.01
Regulatory T cells+0.48<0.001
M2 Macrophages+0.53<0.001
Dendritic cells-0.28<0.05
Natural Killer cells-0.36<0.01

These findings have significant implications for immunotherapy approaches targeting GBM, as Spag4 expression levels may serve as a predictive biomarker for immunotherapy response. The consistent correlation patterns across multiple datasets strengthen the case for Spag4 as both a therapeutic target and a potential stratification marker for precision medicine approaches in GBM treatment .

What are the optimal conditions for functional assays to evaluate the effects of anti-Spag4 antibodies on sperm capacitation and acrosome reaction?

Designing robust functional assays to evaluate anti-Spag4 antibody effects requires precise optimization of experimental conditions to ensure physiological relevance and reproducibility. For capacitation assays, freshly collected mouse sperm should be incubated in capacitation medium (typically modified Tyrode's medium supplemented with 5 mg/ml BSA, 15 mM NaHCO₃, and 0.2 mM sodium pyruvate) at 37°C under 5% CO₂ for 60-90 minutes. Anti-Spag4 antibodies should be introduced at concentrations ranging from 10-100 μg/ml, with pre-immune sera or irrelevant antibodies serving as controls. Capacitation status can be most reliably assessed through a combination of chlortetracycline (CTC) staining patterns and tyrosine phosphorylation Western blots using anti-phosphotyrosine antibodies (4G10 or PY20).

For acrosome reaction assays, capacitated sperm should be exposed to physiological inducers including progesterone (10 μM), calcium ionophore A23187 (5 μM), or solubilized zona pellucida proteins (0.5-1 zona equivalents/μl). The optimal protocol involves pre-incubation with anti-Spag4 antibodies for 30 minutes before addition of the acrosome reaction inducer, followed by 30-minute induction. Acrosomal status should be evaluated using dual staining approaches: FITC-conjugated Pisum sativum agglutinin (PSA) or FITC-PNA (peanut agglutinin) for acrosome integrity combined with propidium iodide for viability assessment.

Flow cytometry offers the most objective quantification method, allowing simultaneous assessment of multiple parameters including viability, acrosomal status, and membrane changes. When designing these assays, time-course evaluations are essential, as premature spontaneous acrosome reactions may confound results. Additionally, sperm motility parameters should be concurrently analyzed using computer-assisted sperm analysis (CASA) to distinguish between specific effects on the acrosome reaction versus general impairment of sperm function. This comprehensive approach allows for definitive determination of whether anti-Spag4 antibodies specifically block functional events required for fertilization, following methodological principles established in previous immunological studies targeting acrosomal proteins .

How does Spag4 expression in mouse models translate to understanding human male infertility conditions?

The translational relevance of mouse Spag4 studies to human male infertility involves both direct homology analysis and functional conservation assessment. Human SPAG4 shares approximately 78% amino acid sequence identity with mouse Spag4, with particularly high conservation in functional domains. This conservation suggests that phenotypes observed in mouse models may have direct clinical relevance. Comparative expression studies demonstrate that both human and mouse SPAG4/Spag4 show predominant expression in testicular tissue with similar developmental timing during spermatogenesis, further supporting the translational value of mouse models.

Clinical studies have identified SPAG4 mutations or expression abnormalities in subsets of men with unexplained infertility, particularly those with teratozoospermia (abnormal sperm morphology) and asthenozoospermia (reduced sperm motility). The specific sperm abnormalities observed in these patients closely resemble those documented in Spag4-deficient mouse models, including acrosomal defects and flagellar abnormalities. This phenotypic correlation strengthens the case for using mouse models to investigate potential therapeutic approaches. Researcher seeking to establish translational relevance should employ a comparative approach, analyzing SPAG4/Spag4 expression, localization, and function across species using identical methodologies. Additionally, generating humanized mouse models expressing human SPAG4 variants identified in infertile patients represents an advanced approach to directly test the pathogenicity of specific mutations, providing mechanistic insights with clear clinical applications.

What mechanisms explain the dual role of Spag4 in reproductive biology and cancer progression, particularly in glioblastoma multiforme?

The dual functionality of Spag4 in reproductive biology and cancer progression, particularly in glioblastoma multiforme (GBM), likely stems from its involvement in fundamental cellular processes that become dysregulated in cancer. Molecular analysis suggests that Spag4 participates in cytoskeletal organization and cellular polarity in both sperm development and cancer cell migration. In sperm, these functions support proper morphogenesis and motility, while in GBM cells, the same capabilities may enhance invasive potential and metastatic capacity.

Recent integrated multi-omics analyses have positioned Spag4 within a network of disulfidptosis-related proteins that influence GBM progression . Spag4 shows significant correlations with several immune modulatory genes, including SOD3, SPP1, and FREM3, suggesting its involvement in regulating the tumor immune microenvironment . This immune regulatory function represents a novel aspect of Spag4 biology not previously characterized in reproductive contexts, potentially reflecting context-dependent protein interactions or signaling pathway engagement.

The repurposing of reproductive proteins for oncogenic functions may involve several mechanisms:

  • Aberrant activation of testis-specific promoters in cancer cells (cancer-testis antigen phenomenon)

  • Alternative splicing generating cancer-specific isoforms with modified functionality

  • Post-translational modifications altering protein interactions in the cancer context

  • Subcellular relocalization enabling novel protein interactions

Differential protein interaction networks between testicular and GBM contexts provide the strongest evidence for context-specific functions. In GBM, Spag4 appears to interact with key mediators of cellular redox status and apoptotic pathways, potentially contributing to therapy resistance. Understanding these dual roles requires integrated approaches combining structural biology, interactomics, and functional genomics in both reproductive and cancer models .

How can researchers develop and validate Spag4-targeted therapeutic approaches for glioblastoma that minimize reproductive side effects?

Developing Spag4-targeted therapeutics for glioblastoma while preserving reproductive function requires sophisticated drug design strategies centered on exploiting tissue-specific differences in Spag4 biology. The first critical step involves comprehensive comparative analysis of Spag4 in GBM versus testicular contexts, focusing on potential differences in post-translational modifications, protein-protein interactions, and subcellular localization. This comparative analysis enables identification of GBM-specific vulnerabilities that can be therapeutically targeted.

Small molecule inhibitor development should focus on two primary approaches: (1) targeting GBM-specific interaction interfaces between Spag4 and its oncogenic partners, and (2) exploiting differential accessibility of drug targets between the immune-privileged testis and the partially permeable blood-tumor barrier in GBM. Structure-based drug design utilizing crystallographic or cryo-EM structures of Spag4 complexes can facilitate development of compounds that selectively disrupt cancer-relevant interactions while sparing reproductive functions.

For validation of target specificity, researchers should implement a multi-tiered assessment protocol:

  • Biochemical selectivity assays comparing drug binding to GBM-derived versus testis-derived Spag4 protein complexes

  • Cell-based functional assays in parallel GBM and spermatogenic cell models

  • Tissue distribution studies assessing compound accumulation in brain tumors versus testicular tissue

  • In vivo efficacy and toxicity studies in orthotopic GBM models with concurrent fertility assessment

Additionally, advanced drug delivery strategies can enhance therapeutic specificity, including GBM-targeted nanoparticles, antibody-drug conjugates targeting GBM-specific surface markers, or blood-brain barrier penetrating peptide conjugates. This multi-faceted approach can yield therapeutics that effectively target the oncogenic functions of Spag4 while minimizing reproductive toxicity .

What are the most informative animal models for studying the immunogenicity of Spag4 in contraceptive development?

Non-human primate models represent the most informative systems for evaluating Spag4 immunogenicity for contraceptive development, particularly cynomolgus monkeys which have demonstrated reliable immune responses to sperm antigens in previous studies . These models closely recapitulate human reproductive physiology, immune system dynamics, and contraceptive challenges. When designing immunogenicity studies, researchers should implement a comprehensive evaluation protocol including:

  • Dose-ranging studies to determine minimal effective antigen concentrations

  • Adjuvant comparison trials (aluminum hydroxide demonstrates good safety profiles while eliciting both IgG and IgA responses)

  • Prime-boost interval optimization to maximize antibody titers and persistence

  • Route of administration comparisons (intramuscular versus mucosal delivery)

Immunological assessment should incorporate sophisticated analytical approaches beyond basic antibody titer measurement. Antibody subclass profiling provides critical insights into the nature of the immune response, with IgG1/IgG4 ratios in primates serving as indicators of Th1/Th2 balance. Epitope mapping of the antibody response using peptide arrays or hydrogen-deuterium exchange mass spectrometry reveals which regions of Spag4 elicit neutralizing responses versus non-functional antibodies.

The timing and duration of contraceptive effects should be rigorously evaluated through controlled breeding trials following immunization protocols. Fertility parameters including conception rates, time to conception, and pregnancy outcomes must be systematically documented. Safety assessment must include thorough evaluation of cross-reactivity with non-target tissues and monitoring for potential autoimmune responses. This comprehensive approach in non-human primates provides the most translatable data for human contraceptive development while adhering to established methodological principles from previous sperm antigen vaccine studies .

How can multi-omics approaches be integrated to better understand Spag4's role in both reproductive biology and cancer progression?

Integrating multi-omics approaches to comprehensively understand Spag4's dual roles requires a coordinated experimental design that captures molecular profiles across biological contexts. The foundation of this approach involves parallel genomic, transcriptomic, proteomic, and interactomic analyses in both reproductive tissues and cancer models, with particular emphasis on glioblastoma where Spag4 has demonstrated significance . RNA-sequencing coupled with proteomics can identify context-specific isoforms and post-translational modifications that may explain functional divergence between reproductive and oncogenic roles.

Chromosome immunoprecipitation sequencing (ChIP-seq) and ATAC-seq provide crucial insights into the epigenetic regulation of Spag4 expression across cellular contexts, potentially revealing how this traditionally testis-specific protein becomes activated in cancer cells. These approaches should be complemented by spatial transcriptomics and proteomics to map Spag4 expression patterns within heterogeneous tumor microenvironments, particularly in relation to immune cell infiltration patterns which have shown significant correlation with Spag4 expression .

The integration of these datasets requires sophisticated computational approaches:

  • Network biology algorithms to construct context-specific protein interaction networks

  • Machine learning methods to identify patterns distinguishing reproductive versus oncogenic functions

  • Pathway enrichment analyses to contextualize Spag4 within broader biological processes

  • Multi-modal data integration techniques to correlate expression, localization, and functional impacts

This integrated multi-omics approach has already yielded insights into Spag4's role in disulfidptosis and its potential as a therapeutic target in GBM . The relationships between Spag4 and immune cell populations within the tumor microenvironment highlight its potential role in modulating anti-tumor immunity, a function distinctly different from its reproductive roles. By systematically applying these approaches across biological contexts, researchers can develop a comprehensive understanding of how Spag4 functions are repurposed during carcinogenesis, potentially revealing novel therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.