Recombinant Mouse Spermatid maturation protein 1 (Spem1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a particular tag, please specify it in your order; we will prioritize its inclusion.
Synonyms
Spem1; Spermatid maturation protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Spem1
Target Protein Sequence
MAMAERPRPGWASYQNPNINNCQDMGNSILLLLGLIVCINIGINLVTLLWSRIRILLHRM FHIICEKETSTSLGKLVQPLRKQTYPKVHLRCTMDPVKMTVTPPPTRRRYRHRAPPSRRA RCPIAWAPDTDDEKPPHQHPAICSRHWNDSKDWEGFQSMQEVWEPWTQDGLEQPPQTIRF QPAVEARPLKSEIRSDQGLEAYVYTVNPPPPSPEALSHKNNAAGSGGCVEGEQAQGQPVS PSFLGPANVPEIPRRHSSGRIVYDARDVRRRLRELTQEVEALSHCYPLVSGSSAAEGTGK DWVYRPLKGR
Uniprot No.

Target Background

Function
Essential for efficient cytoplasm removal during spermatogenesis.
Gene References Into Functions
  1. RANBP17 and SPEM1 interactions suggest a potential role for SPEM1 in RANBP17-mediated nucleocytoplasmic transport. PMID: 21184802
  2. UBQLN1 and SPEM1 interactions indicate involvement in regulating protein ubiquitination during spermiogenesis. PMID: 20558241
  3. Spem1, exclusively expressed in the cytoplasm of elongated spermatids (steps 14-16) in mouse testes, plays a critical role in the genetically regulated process of cytoplasm removal. PMID: 17426145
Database Links
Subcellular Location
Membrane; Single-pass membrane protein. Cytoplasm.
Tissue Specificity
Testis-specific. Exclusively present in cytoplasm of steps 14-16 elongated spermatids (at protein level).

Q&A

Basic Research Questions

  • What is Spem1 and what is its role in spermatogenesis?

Spem1 (Spermatid maturation 1) is a previously uncharacterized gene encoding a protein exclusively expressed in the cytoplasm of steps 14-16 elongated spermatids in mouse testis. The protein contains no known functional domains but is highly conserved across mammalian species. Spem1 plays a critical role in proper cytoplasm removal during the final stages of spermiogenesis, which is essential for normal sperm morphology and male fertility .

Methodologically, Spem1's function has been determined through targeted gene knockout studies in mice, where male Spem1-null mice were completely infertile due to deformed sperm. These deformities were characterized by bent heads wrapped around by the neck and middle piece of the tail. Ultrastructural analysis using scanning and transmission electron microscopy revealed that the absence of Spem1 causes failure of cytoplasm to become loose and detach from the head and neck region of developing spermatozoa .

  • How is Spem1 expression regulated during spermatogenesis?

Spem1 expression is strictly regulated in a stage-specific manner during spermatogenesis. Northern blot and RT-PCR analyses show that Spem1 transcripts (approximately 1.2 kb in size) are detected exclusively in the testis. The expression appears to be in a stage-specific manner with lower/absent intensity of hybridization signals at stages V-VII compared to other stages .

Immunohistochemical detection using polyclonal antibodies against full-length Spem1 protein reveals a stage-specific localization pattern with stronger immunoreactivity at stages III-VII and weaker signals at stages I, II, and VIII. This stage-specific expression pattern results from confined expression of Spem1 to the cytoplasm of steps 14-16 spermatids. Interestingly, the onset of Spem1 protein expression occurs later than that of Spem1 mRNA, which is a phenomenon common to numerous genes functioning during late spermiogenesis .

  • What techniques are commonly used to detect and quantify Spem1 expression?

Several complementary techniques can be employed to detect and quantify Spem1 expression in research settings:

  • Northern blot analysis: For tissue-specific expression detection, revealing a ~1.2 kb transcript exclusively in testis

  • RT-PCR: More sensitive detection of mRNA expression across multiple tissues

  • In situ hybridization: Using Spem1-specific antisense riboprobes to localize mRNA expression in testicular sections

  • Immunohistochemistry: Using polyclonal antibodies against full-length Spem1 protein to detect protein expression in testicular sections

  • Western blot analysis: For protein expression detection across multiple tissues

  • Real-time RT-PCR: For quantitative analysis of Spem1 expression levels, particularly useful in clinical samples for predicting sperm retrieval outcomes

These methodologies have consistently demonstrated that Spem1 is exclusively expressed in testis, specifically in the cytoplasm of elongated spermatids at steps 14-16 of spermiogenesis .

  • What phenotypes are observed in Spem1-deficient mice?

Spem1-deficient mice exhibit several distinct phenotypes:

ParameterWild-TypeSpem1-/-
FertilityNormalComplete infertility
Testicular histologyNormal spermatogenesisNormal spermatogenesis
Sperm morphologyNormalSeverely deformed (100% abnormal)
Cytoplasmic dropletsPresentAbsent
Sperm motilityNormal~85% immotile, ~15% reduced motility
Head morphologyStraightBent backward at neck (180°)
Sperm ultrastructureNormalHead-bent/wrapped by neck and middle piece

The most striking phenotype is the severe sperm deformation, characterized by heads bent backward at the neck region, often wrapped around by the neck and middle piece of the tail. Scanning and transmission electron microscopy revealed that these deformations result from failure of proper cytoplasm removal, with retained cytoplasmic components mechanically obstructing the straightening of the sperm head and stretching of the growing tail .

Unlike wild-type sperm that have cytoplasmic droplets normally located between the neck and middle piece, Spem1-null sperm lack these droplets entirely. This suggests that normal cytoplasmic droplet formation may serve as a hallmark for proper cytoplasmic removal, or that formation of normal cytoplasmic droplets is accompanied by proper cytoplasmic removal .

Advanced Research Questions

  • What are the molecular mechanisms by which Spem1 regulates cytoplasm removal during spermiogenesis?

The precise molecular mechanisms by which Spem1 regulates cytoplasm removal remain incompletely understood, but several observations provide insights:

  • Spatial-temporal expression pattern: Spem1 is expressed exclusively in the cytoplasm of steps 14-16 spermatids, coinciding with the timing of cytoplasm removal and spermiation .

  • Ultrastructural analysis: TEM studies of Spem1-null sperm show that cytoplasmic remnants contain numerous interconnected membranous vacuoles, myelin-like discs, and large single vacuoles, which differ structurally from normal cytoplasmic droplets that contain homogenous content with evenly distributed slim leaf-shaped vesicles .

  • Mechanistic implications: The absence of Spem1 appears to prevent the proper detachment of cytoplasm from the nucleus and neck region, suggesting Spem1 may be involved in membrane remodeling processes that facilitate cytoplasm shedding .

  • Relationship to cytoskeletal elements: The localization of defects at the midpiece (sperm head/neck connection) suggests Spem1 incorporation might be linked to cytoskeleton remodeling or manchette formation in elongating spermatids, similar to observations in protamine studies .

Methodologically, future research should focus on identifying Spem1-interacting proteins through co-immunoprecipitation and mass spectrometry approaches, as well as investigating potential roles in membrane dynamics through lipidomic analysis of residual cytoplasmic components in Spem1-null sperm .

  • How can Spem1 knockout mice models be generated and characterized?

Generation and characterization of Spem1 knockout mice involve several methodological steps:

Generation of Spem1-null mice:

  • Targeting construct design: A targeting construct should be designed to delete the entire Spem1 gene, including the 5' UTR and coding exons (except perhaps for the last portion of the final exon) .

  • Homologous recombination in ES cells: The targeting construct is introduced into ES cells (e.g., R1 ES cells) where homologous recombination occurs .

  • ES cell screening: Southern blot analysis using external and internal probes to identify correctly targeted ES cell clones .

  • Chimera generation: Injection of targeted ES cells into blastocysts to generate chimeric mice .

  • Germline transmission confirmation: Southern blot analysis to confirm germline transmission of the knockout allele .

  • PCR-based genotyping protocol: Development of a genotyping protocol to distinguish wild-type and knockout alleles .

Characterization of Spem1-null mice:

  • Verification of gene deletion: Northern blot and Western blot analyses to confirm absence of Spem1 mRNA and protein in knockout mice .

  • Fertility testing: Breeding experiments with wild-type females over 6 months to assess fertility .

  • Testicular histology: Histological examination of testes sections from adult mice .

  • Sperm analysis: Collection and analysis of epididymal sperm for morphology, motility, and ultrastructure using light microscopy, phase contrast microscopy, and scanning/transmission electron microscopy .

  • Sperm function tests: Analysis of sperm capacitation, acrosome reaction, and fertilization capacity .

This comprehensive approach allows for detailed characterization of the phenotypic consequences of Spem1 deletion in vivo .

  • What is the relationship between SPEM1 expression and male infertility in humans?

The relationship between SPEM1 expression and male infertility in humans has been investigated in several studies:

  • Biomarker potential: Among seven testis-specific molecular markers (ESX1, DAZ, DAZL, ZMYND15, PRM1, TNP1, and SPEM1), SPEM1 demonstrated the best positive prediction power (96%) and negative prediction power (85%) at a 0.086 cutoff with an area under the curve (AUC) of 0.91 for predicting successful sperm retrieval in azoospermic men .

  • Expression patterns: Similar to mouse Spem1, human SPEM1 mRNA is detected exclusively in the testis among 17 human tissues tested, suggesting evolutionary conservation of testis-specific expression .

  • Genetic mutations: A recent case study identified a heterozygous mutation c.826C>T (Arg276Trp) in the SPEM1 gene as a potential pathogenic variant leading to teratozoospermic infertility characterized by coiled sperm tails. This mutation had a minor allele frequency of 0.00008176 in the gnomAd database and was absent in the Indian Genome Variations database, representing the first human study reporting a SPEM1 mutation as a cause of coiled sperm tails .

  • Methodological approach for mutation identification: The study employed whole exome sequencing filtered using strict criteria: MAF (<0.003), ALFA project (<0.001), 1000 Genomes (<0.003), Granthem (>50), Polyphen-2 (>0.70), SIFT (<0.03), and PhyloP (>=0) scores. Variants were prioritized based on their roles in spermiogenesis .

These findings suggest that SPEM1 plays a crucial role in human sperm development, and its expression levels or genetic mutations may contribute to male infertility, particularly in cases of teratozoospermia with coiled sperm tails .

  • How does Spem1 function compare to Spem2 in spermatogenesis?

Spem1 and Spem2 are both members of the SPEM family and play critical roles in spermatogenesis, but they exhibit distinct and complementary functions:

Similarities:

  • Both are testis-enriched genes required for proper spermatid development

  • Knockout of either gene results in male infertility due to sperm morphological abnormalities

  • Both proteins are involved in processes occurring during late spermiogenesis

Differences:

CharacteristicSpem1Spem2
Expression timingSteps 14-16 elongated spermatidsPrimarily in elongating spermatids
Primary defect mechanismFailure of cytoplasm to detach from head/neckAbnormal residual body formation and cytoplasmic body
Sperm morphology in KOHead bent at neck, wrapped by midpieceVarious defects including bent heads, clumped heads with cellular remnants, tails coiled around heads
Sperm count reductionNot specified37.6% reduction in cauda epididymis
Sperm abnormality rate~100%97.5%
Ultrastructural findingsCytoplasmic remnants with membranous vacuolesReduced curvature at head tip, discontinuous accessory structure in middle piece

Methodologically, comparative studies of Spem1 and Spem2 knockout models have revealed that while both proteins are essential for normal sperm development, they appear to regulate different aspects of cytoplasm removal and sperm structural formation during late spermiogenesis. These findings suggest that proper cytoplasm removal during spermiogenesis is a complex process requiring multiple proteins acting at different stages or subcellular locations .

  • What experimental approaches can be used to produce and characterize recombinant Spem1 protein?

Production and characterization of recombinant Spem1 protein for research purposes involves several methodological approaches:

Production strategies:

  • Expression vector construction: The full-length Spem1 cDNA (GenBank accession no. EF120626) can be cloned into appropriate expression vectors with affinity tags (His, GST, etc.) .

  • Expression systems: Based on the search results and common practices for mammalian proteins:

    • Bacterial expression (E. coli): Suitable for biochemical studies but may lack post-translational modifications

    • Mammalian cell expression: Provides proper folding and modifications but with lower yield

    • Insect cell expression: Offers a balance between yield and post-translational modifications

  • Purification methods: Chromatographic techniques including affinity chromatography, ion exchange, and size exclusion can be employed for purification .

Characterization methods:

  • Biochemical characterization:

    • SDS-PAGE and Western blotting to confirm protein size and purity

    • Mass spectrometry for protein identification and post-translational modification analysis

    • Circular dichroism spectroscopy for secondary structure analysis

  • Functional characterization:

    • DNA binding assays (if applicable) using electrophoretic mobility shift assays (EMSAs)

    • Protein-protein interaction studies through co-immunoprecipitation with potential binding partners

    • In vitro membrane binding assays to test potential interactions with cellular membranes

For studying DNA-protein interactions specifically, the methodological approaches used for protamine studies could be adapted, including:

  • EMSAs to assess DNA binding properties

  • Bulk and single molecule assays to analyze DNA condensation/decondensation kinetics

  • Analysis of binding affinity and cooperative behavior with other proteins

These approaches would provide valuable insights into the biochemical properties and potential molecular mechanisms of Spem1 protein function.

  • How can experimental design be optimized to study Spem1 function in vivo and in vitro?

Optimizing experimental design to study Spem1 function requires careful consideration of various approaches:

In Vivo Studies:

  • Conditional knockout models: Generate testis-specific or stage-specific Spem1 knockout mice using Cre-loxP system to avoid potential developmental compensation mechanisms .

  • Knock-in models: Create knock-in mice expressing tagged Spem1 (GFP, FLAG) for real-time visualization and protein interaction studies .

  • Point mutation models: Generate mice with specific mutations (e.g., corresponding to human variants) using CRISPR/Cas9 technology to assess structure-function relationships .

  • Quasi-experimental designs: When true experiments are not feasible, consider nonequivalent groups design or natural experiments to study Spem1 function in different contexts .

In Vitro Studies:

  • Testicular organ culture: Develop ex vivo testicular slice culture systems to study Spem1 function in a near-physiological environment .

  • Cell models: Establish cell lines expressing Spem1 to study subcellular localization and protein interactions .

  • High-throughput approaches: Employ RNA-seq analysis of Spem1-deficient testes at different developmental stages to identify downstream effectors .

Statistical considerations:

  • Power analysis: Determine appropriate sample sizes based on expected effect sizes from preliminary data .

  • Randomization: Implement proper randomization strategies to minimize bias in treatment allocation .

  • Blinding: Ensure researchers are blinded to genotype/treatment during data collection and analysis .

  • Controls: Include appropriate negative and positive controls, including heterozygous mice and littermate controls .

Data integration approaches:

  • Multi-omics integration: Combine transcriptomic, proteomic, and metabolomic data to comprehensively understand Spem1 function .

  • Cross-species validation: Compare findings between mouse models and human samples to validate relevance to human fertility .

By implementing these methodological considerations, researchers can design robust experiments to elucidate Spem1 function in spermatogenesis and its potential implications for male fertility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.