Recombinant Mouse Spermatogenesis-associated protein 25 (Spata25)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Spata25; Tsg23; Spermatogenesis-associated protein 25; Testis-specific gene 23 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Spata25
Target Protein Sequence
MSYFVSPQSHLGLLPSGQGGAASSGSSLGLYSPAEPVVVAPGGLGPLSQKAEQVAPAAQA WGPTLAVPEARGCSGGVSWETPRRKEHNRYCPKLPPMRPLESLGWADPCSRSRAPYLGGP SRPRPLLLCGLSPGVLPISSEAGGKEAASQPDICILTLAMMIAGIPTVPVPGLREEDLIR AAQAFMMAHPEPEGAVEGVQWEQAHAHAHMASGQMPLVRSRRGSCL
Uniprot No.

Target Background

Function
Potentially involved in spermatogenesis.
Gene References Into Functions
  1. A study identified a novel gene, TSG23/Tsg23, exhibiting developmental and high expression in the testis. Findings suggest its involvement in human and mouse spermatogenesis. PMID: 19240080
Database Links
Protein Families
SPATA25 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed strongly in testis, weakly in epididymis and not detected in other tissues.

Q&A

What is Spermatogenesis-associated protein 25 (SPATA25) and what is its function?

SPATA25, also known as TSG23, is a protein that plays a significant role in spermatogenesis. It belongs to the SPATA25 family and is classified as an integral membrane protein. The protein is developmentally expressed and highly concentrated in testicular tissue. Its primary biological functions relate to cell differentiation specifically in the context of spermatogenesis . While SPATA25 has been identified as important for reproductive processes, the precise molecular mechanisms by which it contributes to sperm development remain an active area of investigation. Research suggests it may function in regulatory pathways during specific stages of sperm cell maturation.

Where is SPATA25 primarily expressed and what are its key structural characteristics?

SPATA25 is primarily expressed in the testis, as demonstrated by multiple publications associating SPATA25 with testicular tissue . At the chromosomal level, human SPATA25 (ortholog name: C20orf165) is located at position 20q13.12. As an integral membrane protein, SPATA25 contains transmembrane domains that anchor it within cellular membranes, which is significant for understanding its functional context within testicular cells. This membrane localization suggests potential roles in cell-cell communication or signal transduction during spermatogenesis. The protein's structural features, including its transmembrane topology and potential functional domains, are important considerations when designing recombinant versions for research purposes.

How does recombinant SPATA25 differ from native SPATA25?

While specific comparative data between recombinant and native SPATA25 is limited in the available research, insights can be drawn from studies of similar recombinant proteins. For instance, research on recombinant mouse sperm ZP3-binding protein (ZP3R/sp56) demonstrates that properly expressed recombinant proteins can exhibit molecular weights and oligomeric structures similar to their native counterparts .

When working with recombinant SPATA25, researchers should verify:

  • Protein conformation and post-translational modifications

  • Formation of appropriate oligomeric structures (if applicable)

  • Maintenance of proper disulfide bonding patterns

  • Retention of binding properties to natural interaction partners

Functional assays comparing binding properties and biological activities between recombinant and native SPATA25 would be essential to validate the recombinant protein's utility in experimental studies. Expression system selection (bacterial vs. mammalian) significantly impacts these characteristics and should be carefully considered based on experimental requirements.

What are the optimal conditions for expressing recombinant mouse SPATA25?

Based on approaches used for similar recombinant proteins in reproductive biology research, optimal expression of mouse SPATA25 would likely involve mammalian expression systems. Since SPATA25 is an integral membrane protein , special consideration must be given to expression strategies that preserve its native structure.

Expression SystemAdvantagesLimitationsRecommended for SPATA25
E. coliHigh yield, low cost, rapid expressionLimited post-translational modifications, inclusion body formation commonNot ideal for full-length membrane protein
HEK293 cellsMammalian post-translational modifications, secretion capacityLower yield, higher costHighly recommended for full-length SPATA25
CHO cellsStable cell lines, scaled productionLonger development timeGood for long-term production
Insect cells (Sf9/Sf21)Higher yield than mammalian cells, some post-translational modificationsDifferent glycosylation patternsPotential alternative for soluble domains
Cell-free systemsRapid expression, membrane protein compatibilityLow yield, high costUseful for initial screening

Drawing from methods used for other recombinant reproductive proteins , key expression parameters include:

  • Selection of expression vector with strong promoter (CMV or EF1α)

  • Optimization of codon usage for mouse sequences

  • Inclusion of appropriate tags (His, FLAG) for detection and purification

  • Temperature modulation (typically 30-37°C) during expression phase

  • Addition of protease inhibitors during harvest to prevent degradation

Quality control should include western blotting to confirm molecular weight under reducing and non-reducing conditions, particularly important if disulfide bonds are critical for SPATA25 function.

How should experimental designs for SPATA25 binding studies be structured?

When designing experiments to study SPATA25 binding interactions, researchers should follow systematic experimental design principles. The process should begin with clearly defined variables: the independent variable (typically SPATA25 concentration or mutant variants), dependent variables (binding affinity, cellular localization, etc.), and control variables (temperature, pH, buffer composition) .

A well-structured experimental design for SPATA25 binding studies should include:

  • Hypothesis formulation specific to predicted SPATA25 binding partners

  • Treatment design with varying concentrations of recombinant SPATA25 (wide variation to establish dose-response relationships)

  • Appropriate controls including:

    • Non-binding protein controls (ideally similarly sized proteins)

    • Competition assays with unlabeled SPATA25

    • Domain-specific mutations to map binding interfaces

  • Precise measurement protocols for binding affinity (surface plasmon resonance, ELISA, etc.)

  • Statistical analysis plan to determine significance of binding interactions

For testicular cell binding studies, both between-subjects (comparing different cell types) and within-subjects (comparing effects on the same cell type) designs may be appropriate . Researchers should consider external validity factors to ensure findings can be generalized to in vivo contexts.

What purification methods are most effective for recombinant mouse SPATA25?

Effective purification of recombinant mouse SPATA25 would likely utilize a multi-step chromatography approach, drawing from methodologies used for other recombinant proteins in reproductive biology . As an integral membrane protein , special considerations for detergent selection and membrane protein handling are necessary.

A recommended purification workflow would include:

  • Initial capture using affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) if His-tagged

    • Antibody-based affinity if FLAG or other epitope tags are used

  • Intermediate purification:

    • Ion exchange chromatography (IEX) based on SPATA25's theoretical isoelectric point

    • Hydroxyapatite chromatography for additional selectivity

  • Polishing step:

    • Size exclusion chromatography (SEC) to separate monomeric, oligomeric, and aggregated forms

    • Removal of endotoxins for cell-based applications

Considering SPATA25's membrane protein nature , additional considerations include:

  • Use of appropriate detergents during extraction (e.g., CHAPS, DDM, or digitonin)

  • Potential need for lipid reconstitution to maintain native conformation

  • Buffer optimization to ensure protein stability (typically HEPES buffer systems at pH 7.4 with KCl)

Quality control should include SDS-PAGE, western blotting, and activity assays to confirm identity, purity, and functionality of the purified recombinant SPATA25.

How can researchers identify and resolve data contradictions in SPATA25 functional studies?

When analyzing SPATA25 functional data, researchers may encounter contradictions similar to those described in biomedical research data quality assessments . To address these, a structured approach to contradiction identification and resolution is essential.

Researchers should implement a systematic framework considering three key parameters (α, β, θ) as described in data quality literature :

  • α: Number of interdependent items (measurements related to SPATA25 function)

  • β: Number of contradictory dependencies defined by domain experts

  • θ: Minimal number of Boolean rules required to assess these contradictions

For example, when studying SPATA25's role in spermatogenesis, contradictory results might include cases where high SPATA25 levels correlate with reduced sperm counts when the hypothesis predicts the opposite. To systematically address such contradictions:

  • Document all potentially interdependent measurements in your experimental system

  • Define clear rules for what constitutes contradictory results

  • Develop Boolean expressions to detect these contradictions systematically

  • When contradictions are identified:

    • Re-examine experimental protocols for potential methodological issues

    • Consider biological variability and sample heterogeneity

    • Evaluate whether the contradiction represents a novel finding rather than an error

    • Conduct additional validation experiments with modified controls

This structured approach to contradiction analysis enhances data reliability and can lead to refined hypotheses about SPATA25 function.

What quality control measures should be implemented when working with recombinant SPATA25?

Based on standard practices for recombinant proteins in research , comprehensive quality control for recombinant SPATA25 should include:

  • Physical Characterization:

    • SDS-PAGE analysis under reducing and non-reducing conditions

    • Mass spectrometry to confirm protein identity and detect post-translational modifications

    • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Functional Validation:

    • Binding assays to verify interaction with known or predicted partners

    • Cell-based assays to confirm biological activity in relevant testicular cell lines

    • Stability testing under various storage conditions

  • Purity Assessment:

    • Endotoxin testing to ensure preparations are endotoxin-free for cell culture experiments

    • Host cell protein (HCP) analysis to confirm removal of expression system contaminants

    • Aggregation analysis using dynamic light scattering (DLS)

  • Batch Consistency:

    • Lot-to-lot comparison using standardized analytical methods

    • Reference standard development for long-term quality assurance

    • Certificate of analysis (CoA) documentation for each preparation

Implementing these quality control measures ensures that experimental outcomes can be attributed to SPATA25 activity rather than contaminants or structural variations, enhancing reproducibility across studies.

How can researchers distinguish between specific and non-specific effects in SPATA25 functional assays?

Distinguishing specific from non-specific effects in SPATA25 functional assays requires robust experimental controls and validation approaches. Drawing from principles used in other recombinant protein studies , researchers should implement the following strategies:

  • Control Proteins:

    • Use structurally similar but functionally distinct proteins as negative controls

    • Include gradient concentrations of SPATA25 to establish dose-dependency

    • Compare wild-type SPATA25 with mutated versions lacking key functional domains

  • Competitive Binding Assays:

    • Perform competition experiments with unlabeled SPATA25 to displace labeled protein

    • Include excess non-specific blockers (e.g., BSA) to reduce background binding

    • Use targeted blocking antibodies against specific domains of SPATA25

  • Validation Across Multiple Systems:

    • Confirm findings using different cell types or experimental models

    • Apply orthogonal techniques to measure the same endpoint

    • Correlate in vitro findings with ex vivo or in vivo observations

  • Statistical Analysis:

    • Calculate signal-to-noise ratios to quantify specific binding

    • Determine Z-factors for high-throughput assays to ensure assay quality

    • Apply appropriate statistical tests to distinguish significant specific effects from background variation

By implementing these approaches, researchers can increase confidence that observed effects are genuinely attributable to SPATA25's biological activity rather than experimental artifacts or non-specific interactions.

How can recombinant SPATA25 be applied in studies of male fertility and contraception research?

Recombinant SPATA25 offers significant potential for advancing male fertility and contraception research. Drawing from approaches used with other reproductive proteins , researchers can utilize recombinant SPATA25 in several sophisticated applications:

  • Fertility Assessment Tools:

    • Development of immunoassays to measure SPATA25 levels in seminal fluid as potential biomarkers of spermatogenesis quality

    • Creation of diagnostic tools to detect anti-SPATA25 antibodies that might contribute to immunological infertility

  • Contraceptive Development:

    • Screening of compounds that modulate SPATA25 function as potential non-hormonal contraceptive agents

    • Evaluation of SPATA25 as a target for immunocontraception approaches

  • Therapeutic Applications:

    • Investigation of recombinant SPATA25 supplementation to enhance in vitro spermatogenesis

    • Development of SPATA25-based treatments for specific forms of male infertility

  • Mechanistic Studies:

    • Use of structurally modified SPATA25 variants to elucidate structure-function relationships

    • Application in co-culture systems to understand cell-cell communication during sperm development

These applications should be approached with rigorous experimental design principles , including appropriate controls, dose-response assessments, and validation across multiple model systems to establish translational potential.

What are the methodological approaches for investigating SPATA25 interactions with other proteins during spermatogenesis?

Investigating SPATA25 protein interactions requires sophisticated methodological approaches that can capture both stable and transient interactions in the complex cellular environment of spermatogenesis.

MethodDetection SensitivityInteraction TypeAdvantagesLimitations
Co-immunoprecipitationMediumStable complexesNative conditions, identifies complexesRequires high-quality antibodies
Proximity labeling (BioID)HighTransient interactionsCaptures weak/transient interactionsPotential false positives
Crosslinking-MSHighStable and transientProvides structural informationComplex data analysis
Y2H screeningMedium-HighBinary interactionsHigh-throughput screeningHigh false positive rate
FRET/BRETMediumIn vivo interactionsReal-time observation in cellsRequires protein tagging

Building on approaches used for other reproductive proteins , researchers should consider:

  • In Vitro Interaction Studies:

    • Yeast two-hybrid (Y2H) screening to identify potential binding partners

    • Pull-down assays using tagged recombinant SPATA25 as bait

    • Surface plasmon resonance (SPR) to determine binding kinetics with candidate partners

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization of interactions

  • Cell-Based Approaches:

    • Co-immunoprecipitation (Co-IP) from testicular cell lysates followed by mass spectrometry

    • Proximity labeling methods (BioID, APEX) to capture transient interactions

    • Fluorescence resonance energy transfer (FRET) to visualize interactions in live cells

    • Mammalian two-hybrid assays for validation in relevant cellular contexts

  • Systems Biology Integration:

    • Correlation of SPATA25 interactome with transcriptomic data from different stages of spermatogenesis

    • Network analysis to identify functional clusters of interacting proteins

    • Temporal mapping of interaction dynamics during sperm cell differentiation

  • Validation and Functional Characterization:

    • CRISPR-Cas9 modification of interaction domains to confirm specificity

    • Competitive displacement assays to assess binding site overlap

    • Functional assays to determine the biological significance of identified interactions

Predicted SPATA25 Interaction PartnersEvidence TypeBiological ProcessInteraction Domain
Testis-specific protein kinasesPredicted by homologySignaling during spermatogenesisCytoplasmic domain
Membrane transport proteinsInferred from other SPATA family membersIon/nutrient transportTransmembrane region
Nuclear factors (post-meiotic)Based on spermatogenesis stage expressionChromatin remodelingNuclear localization signal
Cytoskeletal proteinsCommon in sperm developmentFlagellar developmentC-terminal region
Zona pellucida proteinsSimilar to ZP-binding proteins Sperm-egg interactionExtracellular domain

What are the best approaches for studying the role of SPATA25 in animal models of male reproductive disorders?

Studying SPATA25 in animal models of male reproductive disorders requires carefully designed experimental approaches that balance physiological relevance with specific mechanistic questions. Building on established experimental design principles 5, researchers should consider the following methodological strategies:

  • Genetic Modification Approaches:

    • CRISPR-Cas9 generation of SPATA25 knockout or knockin mouse models

    • Conditional knockout systems (Cre-loxP) for cell-type specific or temporally controlled SPATA25 deletion

    • Transgenic overexpression models to assess gain-of-function effects

    • Point mutation models to study specific functional domains

  • Reproductive Phenotyping:

    • Comprehensive spermatogenesis assessment including histological analysis of testicular architecture

    • Sperm parameter analysis (count, motility, morphology, capacitation)

    • Fertility testing through natural mating and in vitro fertilization

    • Molecular profiling of testicular tissue (transcriptomics, proteomics, metabolomics)

  • Intervention Studies:

    • Recombinant SPATA25 administration to assess rescue of phenotypes in deficiency models

    • Antibody neutralization studies to temporarily block SPATA25 function

    • Small molecule modulators of SPATA25 to assess therapeutic potential

    • Combination approaches targeting SPATA25 and interacting pathways

  • Translational Approaches:

    • Correlation of animal model findings with human patient samples

    • Comparative analysis across multiple species to identify conserved mechanisms

    • Development of biomarkers based on SPATA25 function for clinical application

These approaches should be implemented with rigorous experimental design principles , including appropriate sample sizes, control groups, blinding of assessors, and comprehensive statistical analysis to ensure robust and reproducible findings that can advance our understanding of SPATA25's role in male reproductive health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.