Recombinant Mouse Spermatogenesis-associated protein 9 (Spata9)

Shipped with Ice Packs
In Stock

Description

General Information

Spermatogenesis-associated protein 9 (SPATA9) is a protein that, in humans, is encoded by the SPATA9 gene . The SPATA9 gene is located on human chromosome 17q21.33, a region that is syntenic with mouse chromosome 11 . SPATA9 exhibits structural homology to c-Jun N-terminal kinase (JNK)-interacting protein 3 . It has been recently classified as JIP4 protein .

Protein Structure and Characteristics

SPATA9 possesses a JNK-binding domain and predicted coiled-coil, leucine zipper, and transmembrane domains . Secondary structure analysis has indicated that SPATA9 has an α-helical structure . Microsequencing of recombinant SPATA9 aggregates confirmed the amino acid sequence and mono atomic mass of 83.9 kDa .

Expression and Localization

SPATA9 is expressed exclusively in the testis . SPATA9 is present in haploid round spermatid cells during spermatogenesis in macaques, baboons, and humans . Polyclonal antibodies against recombinant SPATA9 have recognized the native protein in human sperm extracts and localized it to the acrosomal compartment of intact human spermatozoa . SPATA9 immunofluorescence was observed in acrosome-reacted spermatozoa, which indicated its retention on the equatorial segment after the acrosome reaction .

Functional Significance

SPATA9 interacts with JNK3 and JNK2 with higher binding affinity compared to JNK1 . No interaction was observed with p38α or extracellular-signal-regulated kinase pathways . Anti-SPATA9 antibodies have been shown to inhibit the binding of human spermatozoa to intact human oocytes and hemizona . SPATA9 may have a role in spermatozoa–egg interaction .

Association with Male Infertility

Studies are ongoing to identify novel reproductive tract-specific genes that could serve as potential drug targets, furthering the understanding of male reproductive physiology and addressing male infertility . Genome-wide association studies have identified SPATA9 as a potential gene of interest in relation to erythrocyte traits .

Genome-Wide Association Studies (GWAS)

GWAS have been conducted to identify genes associated with various traits . SPATA9 has been identified as one of six genes of interest via gene function annotations and location .

Quantile-Quantile (Q-Q) Plots

Q-Q plots are used in GWAS to assess the distribution of p-values and to evaluate the presence of population stratification or other confounding factors .

Single-Marker Analysis

Single-marker analysis involves testing each SNP (single nucleotide polymorphism) individually for association with the trait of interest . Forty-two significant SNPs were detected via single-marker analysis, which involved six erythrocyte traits .

Haplotype Analysis

Haplotype analysis examines the association of haplotypes (combinations of SNPs) with the trait of interest . Haplotype-based analysis and single-nucleotide polymorphism analysis can detect different associations .

Insomnia Meta-Analysis

A genome-wide meta-analysis of insomnia was conducted, involving data from the UK Biobank study and 23andMe, Inc . This meta-analysis identified 554 loci, implicating 3,898 genes . A novel strategy was proposed to prioritize genes using external biological resources and functional interactions between genes across risk loci .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Spata9; Spermatogenesis-associated protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Spata9
Target Protein Sequence
MEVRPIGWICGQVVKNFSGRLEGLQKAIMDLIDEFKDDLPTILRLSQSSQKTDPVQKTSK VRMALALAKINRGTLIQGLNHISSSSKSVAKLLQPRLAYRLLELRSISHRLLREVNVASQ PLHSVQMKRGSLFEIISFPAKTALTSIMYASYAALIYLAVCVNAVLAKIKKIFQEEESIR QNRESENFRKAFSEPALRKPMFSESEIKAKPYRSLPEKPDNLLDQPKPPANKQSNKIQVL HSVFDQLAELNE
Uniprot No.

Target Background

Function
Plays a potential role in testicular development and spermatogenesis; may be a significant factor in male infertility.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic function of mouse Spata9 in spermatogenesis?

Spata9 (also known as NYD-SP16) is a protein predicted to be involved in testicular development and spermatogenesis . It appears to be an integral component of the membrane and plays critical roles in cell differentiation during the process of sperm development . Unlike some other spermatogenesis-associated proteins that are expressed throughout multiple tissues, Spata9 demonstrates a relatively specific expression pattern in testicular tissue, with notable elevation during specific stages of germ cell development .

What is the expression pattern of Spata9 during mouse spermatogenesis?

Based on single-cell RNA-seq data analysis, Spata9 expression follows a stage-specific pattern during spermatogenesis. The protein demonstrates increased expression in specific germ cell populations, particularly during the transition between spermatogonial and spermatocyte stages . Unlike some other spermatogenesis regulators such as XAP5 (which is predominantly expressed in spermatogonia) or XAP5L (which is found in pachytene spermatocytes and remains until elongating spermatids), Spata9 shows a distinct temporal expression pattern that correlates with key transition phases in sperm development .

How is Spata9 structurally characterized compared to other spermatogenesis-associated proteins?

Spata9 is a protein-coding gene located in the genome with specific structural characteristics. Unlike multidrug resistance-associated proteins such as MRP9 (ABCC12), which contains complex transmembrane domains and shows alternative splicing patterns, Spata9 has a more straightforward protein structure . The protein is predicted to be an integral membrane component, suggesting it contains transmembrane domains that anchor it within cellular membranes during spermatogenesis . As a fundamental step in structural characterization, researchers should verify protein expression using techniques such as Western blotting with appropriate antibodies to confirm the molecular weight and presence of post-translational modifications.

What are the recommended methods for generating knockout or knockdown models to study Spata9 function?

For studying Spata9 function, researchers have multiple options for generating knockout or knockdown models:

  • CRISPR-Cas9 System: For generating complete knockout models, the CRISPR-Cas9 system has proven effective in creating specific gene disruptions. When targeting Spata9, design multiple guide RNAs targeting conserved exons to ensure functional disruption. Following a similar approach to that used for XAP5L knockout mice would be advisable .

  • Conditional Knockout Approach: For developmental studies where complete knockout might be lethal, consider generating floxed-Spata9 mice and crossing them with tissue-specific Cre lines such as Stra8-GFPCre for germline-specific knockout, as demonstrated for XAP5 .

  • Verification Methods: Regardless of the approach, verification of knockout efficiency should include:

    • PCR genotyping of genomic DNA

    • RT-qPCR for mRNA expression levels

    • Western blot analysis of protein expression

    • Immunofluorescence staining in testicular cross-sections

Table 1: Comparison of Gene Disruption Methods for Studying Spata9

MethodAdvantagesLimitationsVerification Requirements
CRISPR-Cas9 Global KOComplete gene ablation; definitive phenotype assessmentPotential embryonic lethality; compensatory mechanismsGenomic PCR, Western blot, RT-qPCR
Conditional KOTissue-specific disruption; temporal controlMore complex breeding; mosaic expression potentialTissue-specific verification of deletion, functional assessment
siRNA/shRNA KnockdownRapid implementation; usable in cell cultureIncomplete knockdown; transient effectsWestern blot verification, rescue experiments
CRISPR InterferenceTunable repression; reversibleSystem-specific optimization neededRT-qPCR, ChIP for target site verification

What experimental design approaches are most effective for studying Spata9 in mouse spermatogenesis?

When designing experiments to study Spata9's role in spermatogenesis, consider the following methodological approach:

  • Define your variables clearly :

    • Independent variable: Spata9 expression level (wild-type, knockout, overexpression)

    • Dependent variables: Spermatogenic cycle progression, sperm count, sperm morphology, fertility outcomes

    • Control for extraneous variables: genetic background, age, environmental factors

  • Create appropriate experimental groups :

    • Use a between-subjects design with matched controls

    • Include positive controls (known fertility factors) to validate experimental sensitivity

  • Longitudinal assessment:

    • Analyze spermatogenesis at different developmental time points (P16, P21, adult) to capture the dynamic process

    • Use histological analysis of seminiferous tubules to evaluate cell types and progression

    • Implement computer simulation models to predict and interpret temporal-spatial dynamics

  • Comprehensive phenotyping:

    • Assess gross morphology of testes

    • Perform histological analysis of seminiferous epithelial cycle

    • Evaluate sperm motility and flagellar morphology

    • Measure fertility outcomes through breeding experiments

The most robust experimental designs will combine genetic manipulation of Spata9 with comprehensive phenotypic assessment across multiple time points to establish causative relationships between Spata9 function and spermatogenic outcomes.

How can I effectively purify recombinant mouse Spata9 protein for functional studies?

For effective purification of recombinant mouse Spata9:

  • Expression System Selection:

    • Mammalian systems (HEK-293 cells) are preferred for proper folding and post-translational modifications

    • Alternatively, baculovirus/Sf9 insect cell system can be used for higher yield, following protocols similar to those used for other membrane-associated proteins

  • Construct Design:

    • Include a cleavable tag (His, GST, or FLAG) for purification

    • Consider removing predicted transmembrane domains if they interfere with solubility

    • Optimize codon usage for the expression system

  • Purification Protocol:

    • For membrane proteins, use appropriate detergents for solubilization (e.g., DDM, CHAPS)

    • Implement a two-step purification approach (affinity chromatography followed by size exclusion)

    • Verify protein integrity through Western blotting with specific antibodies

  • Quality Control:

    • Confirm protein purity by SDS-PAGE

    • Verify proper folding through circular dichroism

    • Assess activity through appropriate functional assays

When working with membrane-associated proteins like Spata9, careful optimization of detergent conditions is crucial for maintaining native conformation while achieving adequate solubilization.

How can single-cell RNA-seq approaches be optimized for studying Spata9's role in specific stages of spermatogenesis?

Single-cell RNA-seq (scRNA-seq) offers powerful insights into the dynamic expression patterns of Spata9 during spermatogenesis. To optimize this approach:

  • Cell Isolation Strategy:

    • Combine transgenic labeling with synchronization of the seminiferous epithelium cycle

    • Use enzymatic digestion optimized for testicular tissue to obtain single-cell suspensions

    • Consider developmental timing carefully (prepubertal vs. adult mice)

  • Technical Considerations:

    • Ensure high-quality single-cell isolation using microfluidic platforms

    • Optimize lysis and reverse transcription protocols for testicular cells

    • Include spike-in controls to assess technical variation

  • Analytical Framework:

    • Apply specialized computational methods to overcome technology-specific limitations such as dropout events

    • Use trajectory inference algorithms to map developmental progression

    • Integrate spatial information through computational approaches

  • Validation Strategy:

    • Confirm key findings with alternative methodologies (e.g., in situ hybridization, immunohistochemistry)

    • Use isolated cell populations for functional validation experiments

    • Apply CRISPR screening approaches to validate gene regulatory networks

By capturing cells across the continuous process of spermatogenesis, scRNA-seq can reveal the precise timing of Spata9 expression relative to other key regulatory factors and identify potential interaction partners through co-expression analysis .

What are the most promising approaches for studying Spata9's role in male infertility models?

To investigate Spata9's potential role in male infertility:

  • Genetic Association Studies:

    • Analyze large-scale genomic data to identify SPATA9 variants associated with male infertility

    • Apply approaches similar to GWAS methodologies used in other contexts

    • Calculate heritability estimates for Spata9-associated phenotypes

  • Mechanistic Studies:

    • Generate conditional knockout models targeting specific stages of spermatogenesis

    • Analyze the impact on specific cellular processes (meiotic progression, flagellar assembly)

    • Investigate interactions with known fertility factors

  • Translational Approaches:

    • Develop screening assays for human samples to identify SPATA9 mutations

    • Establish in vitro systems to model the impact of specific variants

    • Create humanized mouse models carrying human SPATA9 variants

  • Therapeutic Exploration:

    • Investigate whether restoring Spata9 function can rescue fertility phenotypes

    • Explore small molecule modulators of related pathways

    • Develop targeted approaches for specific Spata9-dependent processes

When designing these studies, it's essential to consider both the direct effects of Spata9 dysfunction and potential compensatory mechanisms that may obscure phenotypes in certain genetic backgrounds or experimental conditions.

How can spatial transcriptomics be applied to better understand Spata9 function in testicular tissue?

Spatial transcriptomics offers unique insights into the localization of Spata9 expression within testicular tissue architecture:

  • Methodological Approaches:

    • Apply high-resolution spatial transcriptomic technologies like Visium or MERFISH for comprehensive analysis

    • Optimize tissue preparation protocols specifically for testicular samples

    • Consider developmental timing and cycle stage when collecting samples

  • Data Integration Framework:

    • Combine spatial data with single-cell RNA-seq for comprehensive understanding

    • Use computational methods for registration and alignment of multiple tissue sections

    • Apply deconvolution algorithms to estimate cell type compositions

  • Analysis Strategy:

    • Map Spata9 expression onto the spatiotemporal dynamics of the spermatogenic cycle

    • Identify co-expression patterns with proximity-based analysis

    • Correlate expression with structural features of seminiferous tubules

  • Validation Approach:

    • Confirm spatial patterns with immunohistochemistry

    • Use laser capture microdissection to isolate regions of interest

    • Validate functional hypotheses with targeted interventions

This approach can reveal whether Spata9 expression follows specific patterns within the seminiferous tubule architecture, potentially identifying microenvironmental factors that regulate its expression and function.

What computational approaches are recommended for analyzing Spata9 expression data across spermatogenic stages?

For robust analysis of Spata9 expression:

  • Normalization and Batch Correction:

    • Apply appropriate normalization methods for the data type (bulk RNA-seq, scRNA-seq)

    • Implement batch correction algorithms to integrate data from multiple sources

    • Consider testis-specific factors that might influence expression data

  • Developmental Trajectory Analysis:

    • Implement pseudotime algorithms to order cells along developmental trajectories

    • Map Spata9 expression changes against known marker genes

    • Use computer simulation models to predict expression dynamics

  • Network Analysis:

    • Construct gene regulatory networks to identify factors controlling Spata9 expression

    • Apply module detection algorithms to find co-regulated gene sets

    • Integrate transcription factor binding data when available

  • Visualization Approaches:

    • Generate developmental heatmaps showing expression across stages

    • Create interactive visualizations of spermatogenic progression

    • Implement dimensionality reduction techniques (tSNE, UMAP) for scRNA-seq data

Table 2: Computational Tools for Analyzing Spata9 Expression Data

Analysis TypeRecommended ToolsKey FeaturesApplication to Spata9
Differential ExpressionDESeq2, edgeR, limmaStatistical rigor, batch correctionCompare expression between developmental stages
Trajectory AnalysisMonocle3, Slingshot, PAGAPseudotime ordering, branching trajectoriesMap Spata9 dynamics across spermatogenesis
Network AnalysisWGCNA, ARACNeCo-expression modules, regulatory inferenceIdentify regulatory factors of Spata9
Spatial AnalysisSeurat, STUtility, GiottoIntegration with scRNA-seq, spatial statisticsMap Spata9 within testicular architecture

How should researchers interpret contradictory findings about Spata9 function in different experimental models?

When faced with contradictory findings about Spata9 function:

  • Systematic Comparison of Methodologies:

    • Analyze differences in genetic backgrounds used (strain-specific effects)

    • Compare the specificity and validation of knockout/knockdown approaches

    • Evaluate differences in phenotyping methods and outcome measures

  • Consider Context-Dependent Effects:

    • Assess developmental timing differences between studies

    • Evaluate environmental factors that might influence phenotypes

    • Investigate potential compensatory mechanisms in different models

  • Statistical Reassessment:

    • Examine sample sizes and statistical power across studies

    • Consider whether appropriate statistical tests were applied

    • Evaluate reproducibility and replication attempts

  • Integration Framework:

    • Develop hypotheses that could reconcile seemingly contradictory findings

    • Design experiments specifically to test these integrative hypotheses

    • Consider creating a meta-analysis if sufficient studies exist

When evaluating contradictory findings, remember that biological context matters significantly in spermatogenesis research, as the process involves complex, stage-specific regulations that may produce different outcomes depending on when and how Spata9 function is disrupted.

What are the recommended approaches for integrating Spata9 expression data with broader multi-omics datasets?

For effective multi-omics integration:

  • Data Harmonization:

    • Develop consistent sample processing workflows across omics platforms

    • Implement appropriate normalization strategies for each data type

    • Create unified metadata frameworks to facilitate integration

  • Integration Methodologies:

    • Apply factor analysis methods (MOFA, JIVE) for unsupervised integration

    • Use network-based approaches to identify cross-omics relationships

    • Implement Bayesian integration frameworks for mechanistic insights

  • Validation Strategy:

    • Design targeted experiments to validate key predictions

    • Use orthogonal techniques to confirm cross-platform findings

    • Implement perturbation studies to test causal relationships

  • Biological Interpretation:

    • Map integrated results onto known spermatogenic pathways

    • Identify novel regulatory relationships involving Spata9

    • Generate testable hypotheses about Spata9's functional interactions

Multi-omics integration can reveal connections between Spata9 expression, epigenetic regulation, protein interactions, and metabolic processes that might not be apparent when analyzing any single data type in isolation.

What are common challenges in generating reliable antibodies against mouse Spata9 and how can they be addressed?

Researchers frequently encounter challenges with Spata9 antibodies:

  • Common Challenges:

    • Low immunogenicity of certain Spata9 epitopes

    • Cross-reactivity with related proteins

    • Limited accessibility of membrane-embedded regions

    • Poor performance in specific applications (IHC vs. Western blot)

  • Strategic Solutions:

    • Design multiple antibodies targeting different regions (N-terminal, C-terminal, specific domains)

    • Implement rigorous validation using knockout controls

    • Consider generating monoclonal antibodies for improved specificity

    • Optimize fixation and antigen retrieval for membrane proteins

  • Validation Requirements:

    • Confirm specificity using Spata9 knockout tissues

    • Perform peptide competition assays

    • Validate across multiple applications (Western blot, IHC, IP)

    • Include positive and negative control tissues

  • Alternative Approaches:

    • Use epitope tagging in experimental models when possible

    • Consider proximity labeling approaches (BioID, APEX)

    • Implement mass spectrometry-based detection methods

Proper validation of antibodies is critical for reliable results, especially when studying proteins with limited prior characterization like Spata9.

How can researchers troubleshoot failed recombinant expression of functional mouse Spata9 protein?

When encountering difficulties with recombinant Spata9 expression:

  • Expression System Optimization:

    • Test multiple expression systems (bacterial, insect, mammalian)

    • Consider specialized systems for membrane proteins

    • Evaluate expression at different temperatures and induction conditions

  • Construct Modification Strategies:

    • Remove predicted problematic regions (e.g., transmembrane domains)

    • Test fusion partners that enhance solubility (MBP, SUMO, thioredoxin)

    • Create truncated constructs to identify expressible domains

  • Solubilization Approaches:

    • Screen detergent panels systematically (non-ionic, zwitterionic, etc.)

    • Test different buffer conditions (pH, salt concentration)

    • Consider specialty reagents designed for membrane protein solubilization

  • Quality Control Methods:

    • Implement small-scale expression tests before scaling up

    • Use Western blotting to confirm expression

    • Assess protein folding using limited proteolysis

Similar approaches have been successfully applied to other challenging proteins in reproductive biology research, including MRP9 expression in insect Sf9 cells .

What methodological approaches can overcome the challenges of studying temporal dynamics of Spata9 during the spermatogenic cycle?

The dynamic nature of spermatogenesis presents unique challenges:

  • Synchronization Strategies:

    • Implement chemical synchronization protocols (e.g., WIN 18,446 treatment followed by retinoic acid)

    • Use developmental timing in juvenile mice for enrichment of specific stages

    • Apply single-cell approaches to reconstruct developmental trajectories

  • Temporal Sampling Framework:

    • Design longitudinal sampling strategies across the complete cycle

    • Implement systematic staging of seminiferous tubules

    • Use transgenic reporter systems to mark specific developmental stages

  • Computational Approaches:

    • Apply agent-based modeling to simulate temporal dynamics

    • Implement trajectory inference algorithms on single-cell data

    • Develop integrative models incorporating multiple data types

  • Visualization Methods:

    • Generate time-lapse imaging of cultured seminiferous tubules when possible

    • Create developmental timelines integrating multiple markers

    • Implement interactive visualizations of temporal expression patterns

By combining these approaches, researchers can overcome the inherent difficulties in studying the asynchronous and complex process of spermatogenesis and precisely define Spata9's role throughout the cycle.

What emerging technologies show the most promise for elucidating Spata9's molecular mechanisms in spermatogenesis?

Several cutting-edge technologies offer new opportunities:

  • Spatial Multi-omics:

    • Spatial transcriptomics combined with proteomics

    • In situ sequencing approaches for high-resolution mapping

    • Integration of metabolomic information with spatial data

  • Advanced Genetic Engineering:

    • Base editing and prime editing for precise mutation introduction

    • Inducible degradation systems for temporal control

    • Tissue-specific CRISPR screens in reproductive tissues

  • Organoid and Ex Vivo Systems:

    • Testicular organoid systems for functional studies

    • Advanced seminiferous tubule culture methods

    • Microfluidic systems mimicking the testicular microenvironment

  • Computational Biology Approaches:

    • Deep learning for predicting protein interactions

    • Integrative modeling of the spermatogenic cycle

    • Network medicine approaches for infertility research

These technologies, when applied systematically, can provide unprecedented insights into Spata9's specific functions and regulatory mechanisms in spermatogenesis.

How might comparative analysis of Spata9 across species inform our understanding of evolutionary conservation in spermatogenesis?

Comparative analysis offers valuable evolutionary insights:

  • Cross-Species Comparison Framework:

    • Analyze sequence conservation across mammals, vertebrates, and beyond

    • Compare expression patterns in testicular tissue from diverse species

    • Evaluate functional conservation through cross-species complementation

  • Evolutionary Analysis Methods:

    • Apply phylogenetic analysis to identify conserved domains

    • Calculate selective pressure (dN/dS ratios) across protein regions

    • Identify species-specific adaptations in Spata9 sequence and regulation

  • Functional Conservation Testing:

    • Perform cross-species rescue experiments

    • Compare phenotypes of knockout models across species

    • Evaluate binding partner conservation

  • Reproductive Strategy Correlation:

    • Analyze Spata9 structure/function in species with diverse reproductive strategies

    • Correlate molecular features with sperm morphology and function

    • Identify convergent evolutionary patterns in reproductive proteins

This evolutionary perspective can highlight functionally critical domains and potentially identify novel therapeutic targets for fertility interventions based on evolutionarily conserved mechanisms.

What experimental approaches will best characterize the relationship between Spata9 and other spermatogenesis-associated proteins?

To map Spata9's position in the molecular network:

  • Protein Interaction Mapping:

    • Implement proximity labeling approaches (BioID, APEX)

    • Perform co-immunoprecipitation coupled with mass spectrometry

    • Use yeast two-hybrid or mammalian two-hybrid screening

  • Genetic Interaction Analysis:

    • Create double knockout/knockdown models

    • Implement CRISPR interference screens

    • Analyze genetic modifiers of Spata9 phenotypes

  • Transcriptional Regulation Studies:

    • Perform ChIP-seq to identify transcription factors regulating Spata9

    • Use reporter assays to map regulatory elements

    • Apply CRISPR activation/repression to modulate expression

  • High-Content Imaging Approaches:

    • Implement multiplexed immunofluorescence

    • Use super-resolution microscopy for colocalization studies

    • Apply live-cell imaging when possible to track dynamics

By systematically mapping these relationships, researchers can position Spata9 within the broader regulatory network controlling spermatogenesis and identify potential intervention points for fertility modulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.