Recombinant Mouse Sphingolipid delta (4)-desaturase DES1 (Degs1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Sphingolipid delta (4)-desaturase DES1 (Degs1)

Recombinant Mouse Sphingolipid delta (4)-desaturase DES1 (Degs1) is a laboratory-engineered version of the native enzyme found in mouse tissues. This protein belongs to the fatty acid desaturase family, specifically the DEGS subfamily, and functions as a sphingolipid delta-4 desaturase . The enzyme's primary function is converting dihydroceramide to ceramide through the introduction of a double bond between carbons 4 and 5 of the sphingoid base backbone, representing the terminal step in de novo ceramide synthesis .

The recombinant form typically includes epitope tags for detection and purification purposes, such as MYC/DDK (FLAG) tags, which facilitate biochemical studies while maintaining the protein's native enzymatic activity . The availability of recombinant Degs1 has significantly advanced research into sphingolipid metabolism and related disease pathways by enabling detailed investigations of the enzyme's structure, function, and regulation under controlled laboratory conditions.

As an integral membrane protein, Degs1 exhibits complex subcellular targeting and contains multiple transmembrane domains that anchor it within cellular membranes . This structural arrangement is crucial for its enzymatic function and places it in proximity to other components of the sphingolipid biosynthetic machinery.

Nomenclature and Alternative Designations

The enzyme is known by several alternative names in scientific literature and commercial products, reflecting various aspects of its function and evolutionary relationships.

Table 1: Alternative Nomenclature for Recombinant Mouse Degs1

SynonymDescription
DES1Common abbreviated form
Des-1Alternative abbreviated form
FADS7Fatty acid desaturase 7
MGC5079Clone designation
MIG15Alternative designation
MLDAlternative designation
Degenerative spermatocyte homolog 1Full descriptive name based on homology
Dihydroceramide desaturaseFunctional descriptor
Membrane fatty acid desaturaseFunctional descriptor

These various designations appear throughout the scientific literature and in product descriptions, referring to the same enzymatic protein with sphingolipid delta-4 desaturase activity .

Enzymatic Activity and Biochemical Role

Recombinant Mouse Degs1 catalyzes a critical oxidation reaction in sphingolipid metabolism: the conversion of dihydroceramide to ceramide through the introduction of a double bond at the C4 position . This desaturation reaction requires molecular oxygen and involves oxidoreductase activity, positioning Degs1 as a key regulator of ceramide levels within cells.

The enzymatic activity of Degs1 can be measured through various biochemical assays, including those that track the conversion of labeled dihydroceramide substrates to ceramide products using techniques such as HPLC-MS/MS . These assays provide valuable tools for investigating the kinetic properties of the enzyme and its responses to various modulators or inhibitors.

Research has demonstrated that Degs1 activity is influenced by various factors, including post-translational modifications such as N-myristoylation, which affects not only the enzyme's localization but also its catalytic efficiency . Understanding these regulatory mechanisms provides insights into how cells modulate ceramide production in response to various physiological or pathological stimuli.

Involvement in Cellular Signaling and Metabolic Pathways

Degs1 participates in several interconnected metabolic pathways, acting as a crucial node in the network of sphingolipid metabolism and broader lipid homeostasis.

Table 2: Pathway Associations of Recombinant Mouse Degs1

PathwayRole of Degs1Physiological Significance
Ceramide BiosynthesisCatalyzes final step converting dihydroceramide to ceramideCentral to de novo ceramide production
Sphingolipid MetabolismContributes to sphingolipid homeostasisAffects membrane composition and signaling
Fatty Acid MetabolismInvolved in fatty acid modificationConnects sphingolipid and fatty acid pathways
Insulin SignalingModulates ceramide-mediated insulin resistanceInfluences glucose metabolism and energy homeostasis
Apoptotic SignalingRegulates ceramide-induced cell deathContributes to stress responses and tissue homeostasis

The involvement of Degs1 in these pathways positions it as a potential therapeutic target for various conditions, including metabolic disorders, inflammatory diseases, and cancer .

Membrane Distribution and Organelle Association

Recombinant Mouse Degs1, like its endogenous counterpart, exhibits specific subcellular localization patterns that are critical to its function. Research using immunofluorescence microscopy and subcellular fractionation techniques has revealed that Degs1 is primarily associated with the endoplasmic reticulum (ER) membrane, consistent with its role in de novo sphingolipid biosynthesis .

Interestingly, studies have also demonstrated that a portion of Degs1 localizes to mitochondria, particularly when the protein undergoes N-myristoylation . This dual localization pattern suggests that Degs1 may perform distinct functions in different cellular compartments, potentially contributing to compartment-specific ceramide production with unique signaling outcomes.

Native dihydroceramide Δ4-desaturase activity has been detected in both the ER and mitochondria in rat hepatocytes, supporting the functional relevance of this dual localization pattern . The presence of Degs1 in these different membrane systems allows for regulated ceramide production in specific subcellular contexts, which may be particularly important for processes such as apoptosis that involve mitochondrial signaling pathways.

Post-translational Modifications and Their Impact

A significant finding regarding Degs1 localization is the role of N-myristoylation in directing the enzyme to specific cellular compartments. Research has shown that myristoylation of Degs1 targets a portion of the recombinant protein to mitochondria in COS-7 cells . This post-translational modification involves the covalent attachment of myristic acid to the N-terminal glycine residue of the protein, creating a lipid anchor that influences membrane association.

The myristoylation-dependent targeting of Degs1 to mitochondria has functional consequences, as it appears to enhance ceramide production in this organelle and potentially contributes to apoptotic signaling pathways . Expression of wild-type myristoylable Degs1, but not an unmyristoylable mutant (Degs1-Ala), induces apoptosis in COS-7 cells, highlighting the biological significance of this modification .

These findings suggest that post-translational modifications of Degs1, particularly myristoylation, represent important regulatory mechanisms that influence both the subcellular distribution and functional outcomes of the enzyme's activity. Such regulation may allow cells to modulate ceramide production in different compartments based on physiological needs or in response to stress conditions.

De Novo Ceramide Biosynthesis

Recombinant Mouse Degs1 catalyzes the final step in the de novo pathway of ceramide biosynthesis, converting dihydroceramide to ceramide through the introduction of a trans-4,5 double bond . This reaction represents a critical regulatory point in sphingolipid metabolism, as it results in the production of ceramide, a bioactive lipid with significant signaling functions.

Research suggests that the dihydroceramide-to-ceramide conversion catalyzed by Degs1 represents a key regulatory node in sphingolipid metabolism. Dihydroceramide and ceramide possess different biological activities, with ceramide generally exhibiting more potent signaling properties, particularly in relation to apoptosis and stress responses .

Metabolic Implications and Downstream Effects

The activity of Degs1 has broad implications for cellular metabolism and signaling networks, extending beyond its immediate role in ceramide production. By regulating ceramide levels, Degs1 influences various aspects of cellular physiology, including membrane structure, lipid raft formation, and signaling cascades mediated by ceramide and its metabolites.

Studies involving DEGS1 manipulation have revealed interesting connections between this enzyme and metabolic regulation. Heterozygous DEGS1 knockout mice demonstrate enhanced insulin sensitivity and resistance to dexamethasone-induced insulin resistance, suggesting that reduced Degs1 activity may have beneficial effects on glucose metabolism . These findings highlight the potential involvement of Degs1 and ceramide production in the mechanisms of insulin resistance and related metabolic disorders.

Furthermore, ceramide produced by Degs1 serves as a precursor for various complex sphingolipids, including sphingomyelin and glycosphingolipids, as well as other bioactive molecules such as sphingosine and sphingosine-1-phosphate . By controlling the availability of ceramide, Degs1 effectively influences the production of these downstream metabolites, each with distinct biological activities and signaling properties.

Ceramide-Mediated Apoptotic Signaling

Recombinant Mouse Degs1 has significant applications in research on programmed cell death mechanisms due to its role in ceramide production. Ceramide is widely recognized as a pro-apoptotic lipid messenger that contributes to various cell death pathways by affecting membrane properties, activating specific enzymes, and modulating signaling cascades .

Research has demonstrated that expression of wild-type myristoylable Degs1, but not an unmyristoylable mutant, induces apoptosis in COS-7 cells . This finding suggests that the subcellular targeting of Degs1, particularly to mitochondria, influences its ability to generate ceramide in specific cellular compartments and thereby trigger apoptotic cascades.

The conversion of dihydroceramide to ceramide catalyzed by Degs1 appears to be a critical step in certain apoptotic pathways, as dihydroceramide lacks the potent apoptotic properties of ceramide . This distinction highlights the importance of the desaturation reaction in conferring specific signaling capabilities to ceramide molecules, particularly in relation to programmed cell death.

Myristic Acid Effects and Mitochondrial Targeting

An intriguing aspect of Degs1 biology is the relationship between myristic acid, the enzyme's myristoylation, and apoptotic signaling. Research has shown that myristic acid alone can increase cellular ceramide production and induce apoptosis in COS-7 cells . This effect is potentiated when the myristoylable form of Degs1 is expressed, resulting in enhanced caspase activity .

These observations suggest a mechanism whereby myristic acid promotes apoptosis partially through its effects on Degs1 function and subcellular localization. By targeting Degs1 to mitochondria through myristoylation, myristic acid may enhance ceramide production in this organelle, contributing to mitochondrial dysfunction and activation of the intrinsic apoptotic pathway .

The ability of myristoylated Degs1 to generate ceramide in mitochondria may have particular relevance for understanding cellular responses to various stressors and apoptotic stimuli. This targeted ceramide production could influence mitochondrial membrane permeability, cytochrome c release, and subsequent caspase activation, representing a specific mechanism through which sphingolipid metabolism intersects with apoptotic signaling pathways .

Expression Systems for Recombinant Degs1

Various expression systems have been employed for the production of Recombinant Mouse Degs1, each offering specific advantages for different research applications. Common approaches include mammalian expression systems, which provide appropriate post-translational modifications and membrane integration.

Table 3: Expression Systems for Recombinant Mouse Degs1

Expression SystemCharacteristicsApplicationsCitation
HEK293T cellsMammalian system allowing proper folding and post-translational modificationsFunctional studies, protein-protein interactions
COS-7 cellsEfficient expression of membrane proteins with appropriate localizationSubcellular targeting studies, apoptosis research
E. coliHigh yield but limited post-translational modificationsAntibody production, structural studies-
Insect cellsBalance between yield and eukaryotic processingEnzymatic assays, protein purification-

The choice of expression system depends on the specific research questions being addressed. For studies focusing on the catalytic activity and subcellular localization of Degs1, mammalian expression systems are generally preferred as they provide the cellular machinery necessary for proper protein folding, membrane insertion, and post-translational modifications .

Protein Tags and Detection Methods

Recombinant Mouse Degs1 is typically engineered with various epitope tags to facilitate detection, purification, and functional analysis. Common tags include MYC and DDK (FLAG) sequences, which can be recognized by commercially available antibodies for Western blotting, immunoprecipitation, or immunofluorescence microscopy .

The addition of these tags generally does not interfere with the enzymatic activity of Degs1 when positioned appropriately, allowing researchers to track and isolate the recombinant protein while maintaining its functional properties. For instance, C-terminal MYC/DDK-tagged Degs1 expressed in HEK293T cells retains its catalytic activity and proper subcellular localization .

Various detection methods can be employed to analyze Recombinant Mouse Degs1 in experimental systems, including:

  1. Western blotting using antibodies against the protein itself or its epitope tags

  2. Immunofluorescence microscopy for visualization of subcellular localization

  3. ELISA-based assays for quantification in biological samples

  4. Activity assays measuring the conversion of dihydroceramide to ceramide

These approaches provide complementary information about the expression, localization, and function of recombinant Degs1 in different experimental contexts .

ELISA-Based Detection and Quantification

Enzyme-linked immunosorbent assay (ELISA) kits have been developed for the detection and quantification of Mouse Degs1 in various biological samples, offering sensitive and specific methods for analyzing the expression levels of this enzyme . These assays typically employ a sandwich ELISA approach, utilizing antibodies specific for Degs1 to capture the protein from samples and detect it using a secondary detection system.

Commercial ELISA kits for Mouse Degs1 provide high sensitivity and excellent specificity for the detection of this protein, with minimal cross-reactivity with analogous proteins . They can be applied to various sample types including serum, plasma, and other biological fluids, making them valuable tools for studying Degs1 expression in different physiological and pathological contexts.

Table 4: Characteristics of Mouse Degs1 ELISA Detection Systems

FeatureSpecificationApplication
Assay TypeSandwich ELISAQuantitative detection
Sample TypesSerum, plasma, other biological fluidsBroad sample compatibility
SpecificityHigh specificity for Mouse DEGS1Minimal cross-reactivity
Sample Volume1-200 μLAdaptable to various sample quantities
Detection MethodColorimetric (450 nm)Standard laboratory equipment

These assay systems facilitate research into the regulation of Degs1 expression and its correlation with various physiological or pathological conditions .

Functional Assays and Activity Measurements

Several approaches have been developed to assess the enzymatic activity of recombinant Degs1, providing insights into its catalytic properties and regulatory mechanisms:

These functional assays provide valuable tools for investigating the catalytic properties of Degs1, its responses to various modulators or inhibitors, and its roles in cellular processes such as apoptosis and metabolic regulation .

Insulin Sensitivity and Glucose Metabolism

Research involving Degs1 has revealed important connections between this enzyme and metabolic regulation, particularly insulin sensitivity. Studies have shown that heterozygous DEGS1 knockout mice demonstrate enhanced insulin sensitivity, suggesting that reduced activity of this enzyme may have beneficial effects on glucose metabolism .

The relationship between Degs1, ceramide levels, and insulin sensitivity suggests potential therapeutic applications for Degs1 inhibitors or modulators in treating insulin resistance and related metabolic disorders. By reducing ceramide production, such interventions might improve insulin signaling and glucose utilization in tissues such as muscle, liver, and adipose .

Potential Therapeutic Applications

The involvement of Degs1 in various cellular processes and signaling pathways suggests several potential therapeutic applications for modulators of this enzyme's activity:

  1. Metabolic disorders: Inhibition of Degs1 might improve insulin sensitivity and glucose metabolism, offering approaches for treating insulin resistance and type 2 diabetes .

  2. Inflammatory conditions: Modulation of ceramide levels through Degs1 targeting could potentially influence inflammatory signaling pathways, providing strategies for managing inflammatory disorders.

  3. Cancer: Given the role of ceramide in apoptotic signaling, manipulating Degs1 activity might offer approaches for promoting cancer cell death or enhancing the efficacy of existing therapies .

  4. Neurodegenerative diseases: Sphingolipid metabolism has been implicated in various neurodegenerative conditions, suggesting potential applications for Degs1 modulators in this area.

These potential applications highlight the significance of recombinant Degs1 as a tool for drug discovery and the development of targeted interventions for various pathological conditions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format preference, please indicate your requirement in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please communicate with us beforehand as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Degs1; Degs; Des1; Mdes; Sphingolipid delta(4-desaturase DES1; Degenerative spermatocyte homolog 1; Dihydroceramide desaturase-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-323
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Degs1
Target Protein Sequence
GSRVSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNLIWIVAMMLLVQLASFYLV KDLDWKWVIFWSYVFGSCLNHSMTLAIHEISHNFPFGHHKALWNRWFGMFANLSLGVPYS ISFKRYHMDHHRYLGADKIDVDIPTDFEGWFFCTTFRKFVWVILQPLFYAFRPLFINPKP ITYLEIINTVIQITFDIIIYYVFGVKSLVYMLAATLLGLGLHPISGHFIAEHYMFLKGHE TYSYYGPLNLLTFNVGYHNEHHDFPNVPGKNLPMVRKIASEYYDDLPHYNSWIKVLYDFV TDDTISPYSRMKRPPKGNEILE
Uniprot No.

Target Background

Function
Sphingolipid delta (4)-desaturase DES1 (Degs1) exhibits sphingolipid-delta-4-desaturase activity. It converts D-erythro-sphinganine to D-erythro-sphingosine (E-sphing-4-enine) and catalyzes the equilibrium isomerization of retinols.
Gene References Into Functions
  1. Genetic ablation of DEGS1 in preadipocytes inhibited adipogenesis and reduced lipid accumulation. This was associated with elevated oxidative stress, cellular death, and cell cycle arrest. PMID: 25352638
  2. DEGS1 plays a significant role in the hypoxic mouse heart. Hand2 and NFATC physically interact on the DEGS1 promoter. PMID: 23672204
  3. Ablation of dihydroceramide desaturase 1 simultaneously stimulates both anabolic and catabolic signaling pathways. PMID: 23547262
  4. Des1 ablation activated pro-survival and anabolic signaling intermediates (e.g., Akt/PKB, mTOR, MAPK, etc.) and provided protection against apoptosis induced by etoposide. PMID: 22984457
  5. Overexpression of DEGS1 or DEGS2 mitigates the accumulation of DHC and enhances cell proliferation during hypoxia. PMID: 21914808
  6. This study analyzes the regulation of dihydroceramide desaturase by palmitate versus monounsaturated fatty acids and its implications for insulin resistance. PMID: 21454530
  7. The data reveal that CS-mediated SCC lethality was alleviated in irradiated gain-of-function Rad50(s/s) mice, and epistasis studies position Rad50 upstream of Mre11. PMID: 20086180
  8. GT11 is the first specific inhibitor of dihydroceramide desaturase to be described. PMID: 15371559

Show More

Hide All

Database Links
Protein Families
Fatty acid desaturase type 1 family, DEGS subfamily
Subcellular Location
Mitochondrion membrane. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in testis. Detected in pachytene spermatocytes and round spermatids. Expressed in retina and retinal pigment epithelium by Mueller cells (at protein level).

Q&A

What is the biological function of DES1 in sphingolipid metabolism and physiological processes?

DES1 is a critical enzyme that catalyzes the last step in de novo sphingolipid synthesis by inserting a conserved double bond at the 4,5 position in the sphingoid base of dihydroceramides, converting them to ceramides. This conversion is essential for ceramide bioactivity, as studies show that dihydroceramides (lacking the double bond) cannot recapitulate many of the biological effects of ceramides .

The enzyme plays significant roles in several physiological processes:

  • Metabolic regulation: DES1 influences lipid uptake, storage, and glucose utilization

  • Insulin signaling: Ceramides produced by DES1 impair insulin sensitivity

  • Hepatic lipid metabolism: DES1 activity affects hepatic steatosis development

  • Cancer progression: Supports anchorage-independent survival in tumor cells

Research has demonstrated that genetic ablation of DES1 in mouse models resolves hepatic steatosis and insulin resistance caused by both leptin deficiency and obesogenic diets . This highlights DES1 as a potential therapeutic target for metabolic disorders.

How is recombinant mouse DES1 typically expressed and purified for research applications?

Recombinant mouse DES1 (Degs1) can be produced using various expression systems, with E. coli being the most common for research purposes. The purification process typically involves these steps:

  • Gene cloning and vector construction: The Degs1 gene (excluding the signal peptide) is cloned into an appropriate expression vector (e.g., pET series vectors)

  • Expression conditions: The protein is expressed in E. coli strains such as BL21(DE3) under optimized conditions to maximize yield while maintaining proper folding

  • Purification strategies: A multi-step purification process is employed:

    • Initial clarification of bacterial lysate

    • Affinity chromatography (if tagged versions are used)

    • Ion-exchange chromatography (taking advantage of DES1's isoelectric point)

    • Size-exclusion chromatography for final polishing

  • Quality assessment:

    • SDS-PAGE analysis to confirm >85% purity

    • Endotoxin testing to ensure suitability for biological assays

    • Activity testing to confirm functional integrity

The specific approach may be adjusted based on the intended research application, with tagged versions (His-tag, SUMO-tag) often used for easier purification when the tag doesn't interfere with the experimental design .

What are the optimal storage and handling conditions for maintaining recombinant mouse DES1 activity?

To maintain optimal activity and stability of recombinant mouse DES1, researchers should adhere to these evidence-based storage and handling guidelines:

Storage ParameterRecommended ConditionNotes
Short-term storage-20°CSuitable for days to weeks
Long-term storage-80°CPreferred for months to years
Storage bufferTris-based buffer with 50% glycerolOptimized for protein stability
AliquotingSingle-use aliquotsAvoids repeated freeze-thaw cycles
Working temperature4°CWhen actively using the protein
Freeze-thaw cyclesMinimize (ideally <3)Each cycle may reduce activity

When working with the protein:

  • Keep on ice during experiments

  • Use appropriate buffer conditions (pH 7.0-7.5)

  • Include relevant cofactors if enzymatic activity is being measured

  • Consider adding protease inhibitors if used in complex experimental systems

The shelf life of properly stored recombinant DES1 is typically related to multiple factors including buffer composition, storage temperature, and the inherent stability of the protein itself . For quantitative experiments, it is advisable to verify activity before use if the protein has been stored for extended periods.

How can researchers validate the enzymatic activity of recombinant mouse DES1 in experimental systems?

Validating the enzymatic activity of recombinant mouse DES1 requires multiple complementary approaches to ensure functional integrity. Here are methodological approaches with specific protocols:

In vitro enzymatic activity assays:

  • Substrate conversion assay:

    • Incubate purified recombinant DES1 (10-50 μg) with dihydroceramide substrates (10-100 μM)

    • Include cofactors: NADPH (1 mM), oxygen, and appropriate buffer system (pH 7.4)

    • Analyze reaction products by LC-MS or HPLC

    • Calculate conversion rates by measuring the ratio of ceramide formed to dihydroceramide substrate

  • Comparison with SUMO-VS binding assay:
    Similar to methodologies used for DeSI-1 protein , assess binding specificity:

    • Incubate 0.1 nM recombinant DES1 with 0.5-1 μg SUMO1-VS

    • Analyze adduct formation by SDS-PAGE

    • This approach tests structural integrity of the active site

Cellular validation:

  • Reconstitution in DES1-knockout cells:

    • Express recombinant DES1 in CRISPR-generated DES1-knockout cells

    • Measure restoration of ceramide production using lipidomic analysis

    • Quantify ceramide:dihydroceramide ratio as indicator of enzyme activity

  • Functional readouts:

    • Assess downstream effects on Akt/PKB phosphorylation

    • Measure impact on cellular glucose uptake

    • Evaluate changes in lipid droplet formation in hepatocytes

Quality control metrics should include dose-dependent activity measurement and comparison to a reference standard to ensure batch-to-batch consistency in activity.

What genetic modification approaches have been successful for studying DES1 function in mouse models?

Several genetic approaches have been successfully implemented to study DES1 function in mouse models, with specific methodological details:

Conditional knockout strategies:

Researchers have generated mice with exon 2 of the Degs1 gene flanked by LoxP sites (floxed) and backcrossed them 10 times onto the C57BL/6 background. These were then bred with mice expressing various Cre recombinases :

  • Temporal control: Using tamoxifen-inducible Cre-recombinase inserted into the Rosa26 locus

    • Administration protocol: Tamoxifen (2 mg) injected intraperitoneally for 5 consecutive days

    • Verification: Substantial increase in the proportion of sphingolipids lacking the 4,5 double bond

  • Tissue-specific deletion:

    • Adipose-specific: Using adiponectin promoter-driven Cre

    • Liver-specific: AAV-TBG-Cre delivery (adeno-associated virus with thyroid hormone-binding globulin promoter)

    • Intestinal or myeloid cell-specific: Using appropriate tissue-specific Cre lines

RNA interference approaches:

For more acute modulation of DES1 expression:

  • shRNA-mediated knockdown:

    • After screening 10 potential shRNA sequences, researchers identified shRNA8 as producing strong Degs1 knockdown

    • Delivery using adeno-associated viruses (AAVs) at two doses:

      • Low dose: 1 × 10¹¹ genome copies/mouse

      • High dose: 3 × 10¹¹ genome copies/mouse

    • This approach substantially reduced liver ceramide levels

CRISPR-based genome editing:

For generating cell lines:

  • Guide RNAs targeting human DES1 gene (DEGS1) designed to knockout all three reported transcripts (NM_003676, NM_001321541, NM_001321542)

  • Cloned into the Lenticrispr v2.0 plasmid system

  • Selection using puromycin (1-2 μg/ml) for 7 days

Each approach offers distinct advantages depending on the research question, with conditional systems allowing for the study of DES1 in adult animals while avoiding the lethality observed with germline ablation.

How does DES1 influence insulin resistance and hepatic steatosis at the molecular level?

DES1 exerts significant influence on insulin resistance and hepatic steatosis through several interconnected molecular mechanisms:

Impact on insulin signaling pathways:

  • Akt/PKB activation: Liver-specific ablation of DES1 enhances activation of Akt/PKB in vivo, a critical node in insulin signaling

    • Phosphorylation of Akt is increased in DES1-knockout mice

    • This effect contributes to improved glucose handling

  • Lipid-mediated insulin resistance: DES1-derived ceramides impair insulin signaling through:

    • Inhibition of Akt phosphorylation

    • Promotion of protein phosphatase 2A (PP2A) activity

    • Alteration of membrane microdomains essential for insulin receptor signaling

Effects on hepatic lipid metabolism:

  • Transcriptional regulation: RNA-seq experiments revealed that DES1 ablation dramatically lowered hepatic expression of sterol regulatory element binding transcription factor 1 (Srebf1)

    • Srebf1 was the most highly down-regulated gene in DES1 knockout animals fed a normal chow diet

    • It ranked sixth most down-regulated in liver-specific DES1 knockout mice maintained on a high-fat diet

  • Lipid uptake and storage mechanisms: Mechanistic studies revealed DES1-derived ceramides promote:

    • Increased lipid uptake into hepatocytes

    • Enhanced triglyceride synthesis

    • Reduced fatty acid oxidation

  • Physiological outcomes:

    • Decreased liver steatosis

    • Reduced circulating ALT and AST levels (markers of steatohepatitis)

    • Improved glucose tolerance

These molecular effects highlight why DES1 inhibition represents a promising therapeutic strategy for treating metabolic disorders associated with insulin resistance and hepatic steatosis.

What role does DES1 play in cancer progression, particularly in breast cancer models?

DES1 has emerged as a critical factor in cancer progression, with particularly significant roles in breast cancer:

Role in anchorage-independent survival:

Research has identified DES1 as necessary for the acquisition of anchorage-independent survival (AIS), a key cancer-enabling characteristic . Specifically:

  • Mechanistic connection: DES1 functions as a downstream effector of HER2-driven glucose uptake and metabolism

    • Links oncogenic metabolism to survival advantage

    • Provides a metabolic bridge between glucose metabolism and sphingolipid synthesis

  • Experimental evidence:

    • DES1 is sufficient to drive AIS and in vitro tumorigenicity

    • Increased DES1 levels are found in approximately one-third of HER2+ breast cancers

    • Higher DES1 expression correlates with worse survival outcomes

Methods for studying DES1 in cancer contexts:

  • Expression manipulation strategies:

    • Lentiviral vectors for DES1 overexpression in breast cancer cell lines

    • CRISPR-Cas9 for DES1 knockout using guides targeting all three reported transcripts

    • Selection with puromycin (1-2 μg/ml) or blasticidin (10-20 μg/ml) as appropriate

  • Functional assays:

    • Soft agar colony formation to assess anchorage-independent growth

    • Anoikis resistance assays using ultra-low attachment plates

    • Glucose uptake and metabolism measurements

Translational significance:

The research demonstrates that targeting DES1 may be an effective approach for overcoming anchorage-independent survival in metastatic breast cancer. This reveals DES1 as both a potential biomarker of aggressive HER2+ breast cancer and a novel therapeutic target.

What analytical methods are most appropriate for sphingolipid profiling in DES1 research?

Sphingolipid profiling is essential in DES1 research to accurately assess the impact of genetic or pharmacological interventions on sphingolipid metabolism. Here are the most appropriate analytical methods with methodological details:

Liquid Chromatography-Mass Spectrometry (LC-MS/MS):

  • Sample preparation protocol:

    • Tissue homogenization in appropriate buffer

    • Lipid extraction using Bligh-Dyer or modified Folch method

    • Addition of internal standards (e.g., isotope-labeled ceramides)

    • Reconstitution in LC-compatible solvent

  • Analysis parameters:

    • Chromatography: Reverse-phase C18 column with gradient elution

    • MS detection: Multiple reaction monitoring (MRM) for targeted analysis

    • Key analytes: Dihydroceramides, ceramides, sphingomyelins, and glucosylceramides

    • Critical capability: Distinguishing between ceramides and dihydroceramides by mass difference (2 Da)

  • Quantification approach:

    • Use isotope-labeled internal standards for each sphingolipid class

    • Calculate ceramide:dihydroceramide ratio as key indicator of DES1 activity

    • Normalize to total protein or phosphate content

Thin-Layer Chromatography (TLC) with radioisotope detection:

For metabolic labeling studies:

  • Labeling protocol:

    • Incubate cells with ³H-labeled sphingolipid precursors

    • Extract total lipids and separate by TLC

    • Visualize and quantify by phosphorimaging

  • Advantages:

    • Direct visualization of metabolic flux

    • Higher sensitivity for specific pathway analysis

    • Relatively simpler equipment requirements

Immunological detection methods:

For tissue distribution studies:

  • Ceramide-specific antibodies:

    • Immunohistochemistry to visualize ceramide accumulation

    • Can be combined with DES1 staining for colocalization analysis

When selecting an analytical method, researchers should consider:

  • The sensitivity requirements of their experimental system

  • Need for comprehensive profiling vs. targeted analysis

  • Equipment availability and expertise

  • Sample throughput requirements

The gold standard remains LC-MS/MS due to its superior specificity, sensitivity, and ability to distinguish closely related sphingolipid species.

How does recombinant mouse DES1 differ from other recombinant proteins in terms of experimental design considerations?

Working with recombinant mouse DES1 presents unique experimental considerations compared to other recombinant proteins, requiring specific methodological adaptations:

Membrane protein characteristics:

  • Solubility challenges:

    • DES1 is an integral membrane protein with multiple transmembrane domains

    • Requires careful buffer optimization with detergents or lipid environments

    • May benefit from approaches similar to those used for other challenging membrane proteins:

      • Expression as fusion proteins (e.g., SUMO-tag constructs)

      • Refolding protocols similar to those used for TGF-β1

  • Activity preservation:

    • Enzymatic function depends on maintaining proper membrane topology

    • Reconstitution in artificial membrane systems may be necessary for optimal activity

Experimental design considerations:

  • Controls and standards:

    • Use enzymatically inactive mutants (e.g., histidine to alanine mutations in the catalytic site) as negative controls

    • Include known DES1 inhibitors as reference standards

    • Perform parallel experiments with dihydroceramides and ceramides to distinguish substrate vs. product effects

  • Species-specific considerations:

    • Mouse DES1 shares high but not complete homology with human DES1

    • When designing experiments with translational goals, species differences should be acknowledged

    • For cross-species validation, both mouse and human versions may need to be tested in parallel

  • Functional assessment approaches:

    • Unlike many secreted proteins that can be directly added to cells, DES1 typically requires cellular expression or specialized delivery methods

    • Consider using transient transfection, viral transduction, or protein delivery systems (liposomes, cell-penetrating peptides)

    • Activity may be highly context-dependent, requiring assessment in appropriate cellular backgrounds

By addressing these specific considerations, researchers can optimize experimental designs to accurately characterize DES1 function while avoiding technical artifacts.

What survey and experimental design tools are most appropriate for DES1 research across multiple model systems?

When designing comprehensive DES1 research programs across multiple model systems, researchers should employ a systematic approach using appropriate survey and experimental design tools:

Survey design for preliminary research:

  • Literature analysis frameworks:

    • Systematic reviews following PRISMA guidelines

    • Meta-analyses of DES1 manipulation across model systems

    • Use specialized survey tools like Alchemer for research planning and data collection

  • Experimental survey approaches:

    • Screening multiple cell lines for DES1 expression levels using RT-qPCR

    • Tissue expression surveys using immunohistochemistry

    • High-throughput inhibitor screening platforms

Experimental design considerations:

  • Multi-model system approach:

    Model SystemAdvantagesKey Applications
    Cell linesMolecular mechanism studiesSignaling pathway analysis
    Primary cellsPhysiological relevanceMetabolic regulation
    Organ explantsTissue architectureEx vivo drug testing
    Mouse modelsWhole-body physiologyDisease modeling
    Patient samplesClinical relevanceBiomarker validation
  • Statistical design principles:

    • Power analysis to determine appropriate sample sizes

    • Factorial designs to analyze interaction effects between DES1 and other factors

    • Randomization and blinding procedures to minimize bias

    • Longitudinal designs for metabolic phenotyping studies

  • Specialized design tools:

    • MaxDiff surveys for identifying critical experimental parameters

    • Conjoint analysis for optimizing experimental conditions

    • Semantic differential scales for standardizing phenotype assessments

  • Data integration frameworks:

    • Multi-omics approaches combining transcriptomics, proteomics, and lipidomics

    • Network analysis tools to contextualize DES1 within signaling networks

    • Machine learning for pattern recognition across diverse datasets

These approaches should be tailored to specific research questions, with careful consideration of controls, replication, and validation strategies to ensure robust and reproducible findings in DES1 research.

How can researchers effectively troubleshoot inactivity or low activity of recombinant mouse DES1?

When facing challenges with inactivity or low activity of recombinant mouse DES1, researchers should implement a systematic troubleshooting approach:

Protein quality assessment:

  • Structural integrity evaluation:

    • SDS-PAGE analysis under both reducing and non-reducing conditions

    • Circular dichroism spectroscopy to assess secondary structure

    • Thermal shift assays to determine protein stability

    • Size-exclusion chromatography to detect aggregation

  • Post-translational modification analysis:

    • Mass spectrometry to identify unexpected modifications

    • Phosphorylation status assessment (DES1 activity can be regulated by phosphorylation)

    • Glycosylation profiling if expressed in eukaryotic systems

Assay optimization strategies:

  • Buffer composition troubleshooting:

    • Optimize pH (typically 7.0-7.5 for DES1)

    • Test different ionic strengths (50-150 mM NaCl)

    • Evaluate cofactor requirements (NADPH, cytochrome b5)

    • Screen detergent types and concentrations

  • Substrate considerations:

    • Ensure substrate purity and proper solubilization

    • Try different dihydroceramide species (varying acyl chain lengths)

    • Consider using fluorescent or radiolabeled substrates for increased sensitivity

  • Assay conditions optimization:

    • Test temperature range (25-37°C)

    • Optimize enzyme:substrate ratios

    • Vary reaction time (15 minutes to several hours)

    • Consider adding reducing agents (DTT, β-mercaptoethanol)

Expression system adjustments:

If persistent issues occur, consider switching expression systems:

  • Insect cell expression for better membrane protein folding

  • Mammalian cell expression for proper post-translational modifications

  • Cell-free systems with added microsomes for membrane integration

By systematically addressing these factors, researchers can identify and resolve issues affecting recombinant mouse DES1 activity, ensuring reliable experimental outcomes.

What are the emerging applications of DES1 research beyond metabolic disorders and cancer?

Research on DES1 is expanding beyond its established roles in metabolic disorders and cancer, revealing several promising new applications:

Neurodegenerative disorders:

  • Sphingolipid dysregulation in neurodegeneration:

    • DES1-mediated ceramide production impacts neuronal survival

    • Potential role in Alzheimer's and Parkinson's disease pathogenesis

    • Opportunities for neuroprotective interventions through DES1 modulation

  • Methodological approaches:

    • Neuron-specific DES1 knockout models

    • Brain sphingolipidomic profiling

    • Cognitive and behavioral testing in DES1-modified models

Immune system regulation:

  • T-cell differentiation and function:

    • Comparison with recombinant mouse IL-4 effects (0.3-1.5 ng/mL) on immune cell function

    • DES1-derived ceramides modulate T-cell receptor signaling

    • Influence on Th1/Th2/Th17 balance and inflammatory responses

  • Experimental systems:

    • T-cell isolation and culture protocols

    • Cytokine profiling techniques

    • Flow cytometry for immune cell phenotyping

Skin barrier function:

  • Connection with desmoglein pathways:

    • Interaction between DES1 and desmosomal proteins like Desmoglein-1-alpha (Dsg1a)

    • Role in maintaining epithelial integrity

    • Implications for inflammatory skin conditions

  • Research approaches:

    • Skin-specific DES1 knockout models

    • Trans-epidermal water loss measurements

    • Histological assessment of barrier function

Aging biology:

  • Senescence and ceramide accumulation:

    • DES1 activity increases with aging in multiple tissues

    • Potential intervention target for age-related pathologies

    • Connection to cellular senescence mechanisms

  • Experimental design considerations:

    • Age-dependent expression profiling

    • Lifespan studies in DES1-modulated models

    • Integration with other aging pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.